KEGG   Latimeria chalumnae (coelacanth): 102359119Help
Entry
102359119         CDS       T02913                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:lcm00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 617 aa AA seqDB search
MQTVRGRSCLQNLKLREVVSVYFTMLAVVLVILIASFQGVVLKADGFPYKVPLDPQGALE
LSWNISYPEEVVHFQLSVKELKYGVMLGMSDRGEFRNADFVILWSDGHNSYFGDAWSDQH
GRLQLDAQQDYQLLEAHRTPEGLNLIFKRAFSTCDPKDYLIEDGTVHLIYGLLEQPVHSL
GAINISSIPKGLQRVQLLKPEISIPELPDDVVTFEVLAPNVTIPNQETTYWCYITELPDN
FPKHHIVMYEPVITKGNEAIVHHIEVFQCAPEYDTIPHYNGPCDSKMKPERLNYCRHVLA
AWAMGAKAFYYPEEAGLAFGGSGSSKYLRLEVHYHNPLELKGRIDSSGIRLYYTPSLRKY
DAGIMELGLVYTPVMAIPPHEKDFILTGYCTDKCTQTALPHGGIHIFASQLHTHLTGRKV
ATILVRNGAEVEIVNMDNHFSAHFQEIRMLKKVVKVLPGESLITSCTYNTEDRSKATVGG
FGILDEMCVNYIHYYPQSDLELCKSAVDLGYLQKYFNFMNRFNNEEICMCPQASVTEQYN
SVPWNSFSRDVLQSLYDFAPISMHCNKSTALRFPGEWEKQPLPKITKKLPSPVPHCDTTE
CSPAKAPIIVNIDKKKN
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgtcagagggaggtcctgccttcagaatctcaaacttcgagaagtggtttct
gtgtatttcactatgctcgcggtcgtcttggtgatcttgattgcctccttccaaggtgtt
gttctcaaagcagatggcttcccttacaaggtgcctctggatcctcagggggccctggag
ttatcctggaacattagttaccctgaagaggtggtgcattttcaactttcagtcaaagag
ctgaaatatggagtgatgctcgggatgtcagacagaggggagtttagaaatgctgatttt
gtcattctgtggagtgatggacataactcctattttggggatgcctggagcgaccaacac
ggccgcctccagctggatgctcagcaggattaccagcttctggaggcccacagaactcct
gaaggactcaacctgatctttaagagagccttcagcacctgtgacccaaaggattatctc
atcgaggacggaacggttcatcttatatatggactgcttgagcaaccagtgcattccctc
ggagcaattaacatctcttctatccccaagggactccagagggtccaactactgaagcct
gaaataagcatccctgagcttcccgatgatgtggtgacctttgaggtcctagcacccaac
gtcacaattccaaaccaagaaaccacatactggtgctacatcacagagctcccggacaac
tttccaaagcatcacattgtcatgtatgaacctgtgattacaaaaggtaatgaagccatt
gtgcatcacattgaggtcttccagtgtgctccagagtacgacaccatcccacattataat
gggccttgtgactccaagatgaaaccagagcgtctcaactactgcagacatgtactggca
gcgtgggctatgggggcaaaggccttctattatccagaagaggcaggccttgcttttggt
ggatccggctcctcaaagtacttacgccttgaagttcactatcacaacccactggagtta
aaaggccgcatagactcctcagggattcgcttatattacactccttctttaagaaaatac
gatgctggcatcatggagcttggcttggtgtacactccagttatggctattccaccacac
gagaaagacttcatattgacaggatactgcactgacaaatgtacacagacggctttacca
catggaggaatccacatctttgcctcccagttgcacactcacctaacagggagaaaggtg
gcaacgattttagtccgaaatggagcagaagtagaaattgtgaacatggacaatcacttc
agtgcccactttcaggagatccgtatgctaaagaaagttgtcaaagttcttccaggagag
tcgcttataacctcctgtacatacaacacagaagaccgaagcaaagcaaccgtggggggc
tttggaatcctggatgaaatgtgtgtaaactacattcactactaccctcagagtgatctg
gaattgtgtaagagtgctgtggatttagggtacttgcagaaatattttaacttcatgaat
aggtttaataatgaggagatctgcatgtgcccacaagcctctgtgactgagcagtataac
tccgtaccttggaactccttctccagagacgttctgcagtcgctgtacgactttgcccca
atctctatgcactgtaacaaatctacagctctcagatttcctggtgaatgggagaagcag
cctttaccaaagatcaccaagaaactgcccagtccagtccctcactgtgacaccactgaa
tgttccccagcaaaagctccaataatcgtgaatattgacaagaagaaaaactaa

DBGET integrated database retrieval system