KEGG   Latimeria chalumnae (coelacanth): 102359235Help
Entry
102359235         CDS       T02913                                 

Gene name
ST6GAL2
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 2
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:lcm00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:lcm00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 505 aa AA seqDB search
MGPQRILWKQVVLVGVSVWAIILVVLFTYFMETKIDEQAPSSHSFVESKSVAPLQGKMRA
IMGAVKETLITEVQDNLYRNEVVMDSFNEGSESIEEWNELGYSEEFPLEEERNLNKTEND
SLAAGQPGFHNPSSRRGATEENDLLSWAQALKKNSLNSQRHHLLEDSMELEEFYLSSSKS
LLYKLWKGNVSIKMLNPRLQRAVKEYLNFNKHGVRFRGRKSRKKLSAEELLCELKRKIQL
KTIDGKEPPFSALGWEKYVPRIPLNKLNGYRSCAVVTSAGAILDSSLGKEIDSHEAVLRF
NSAPTQGYEKDVGNKTTIRIVNSQILTNPSQHFMDNPLYKDGILVAWDPAPYSVNLKKWY
NKPDYDLFTPYVQYRLKYPGQPFYILHPRFIWQLWDIIQENTQEKIQPNPPSSGFIGILL
MMSMCKEVHVYEFIPSVRQTDLCHYYERYYDAACTLGAYHPVLYEKLLIQRMNKGKEEDL
YRKGKVVLPGFSAMRCTGKNLILQS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggtccccagaggatattgtggaagcaagtagtacttgttggtgtgtctgtttgggcc
atcattcttgtggtcctcttcacctattttatggagactaagatagatgaacaagctccc
agttctcattcctttgttgagtctaaaagtgtagcacctcttcagggcaaaatgagggcc
atcatgggagctgtgaaagagaccctgatcactgaggttcaagataacctctatcgaaat
gaggtggttatggactcatttaatgaaggttctgagagcattgaagagtggaatgaattg
ggctacagtgaagaatttccactagaagaggaaagaaatttgaacaaaactgagaatgat
tctttggctgctggccagccggggtttcataatccttcttccaggagaggggccactgaa
gaaaatgatttactttcttgggcacaagcactgaagaaaaatagtttgaactctcaaaga
caccacctcttggaagactccatggaattggaagagttctatctttcttcatcaaagtcc
ctactttacaaactttggaaagggaacgtgagcatcaagatgttaaatcctcgtcttcaa
agagcagtgaaagagtatctaaacttcaacaaacatggagtccgattcagaggaaggaag
agcaggaaaaagttgtcggcagaagagctgctttgtgaacttaaaaggaagattcaattg
aaaacgatagatggtaaggagcctcccttttcagcacttggatgggaaaagtatgttccc
agaattcctctaaacaaattaaatgggtacagaagctgtgccgtggtgacgtctgctggt
gcaatattagattcctcccttgggaaagaaattgattcccatgaagcagtcttgaggttc
aattctgctcccacgcaaggttatgagaaggacgtagggaataaaactactattcgtatt
gttaattcacagattcttactaatccaagtcagcactttatggacaaccccttgtacaag
gatggtattttagtggcctgggatcctgccccttattctgtgaatcttaaaaagtggtat
aacaaaccagattacgacctcttcaccccttatgtacagtatcgcttgaagtacccaggc
cagccattttacatccttcaccctcggtttatctggcaactttgggatatcattcaggag
aacactcaagagaagattcagcctaacccaccttcctctggctttattgggattcttctt
atgatgtcaatgtgcaaggaagtgcatgtctacgagttcattccttcagtcagacagact
gacctctgtcactattacgaacggtactacgatgcagcctgtactctgggggcataccac
ccagtcctctacgagaagctgctgattcagcggatgaataaaggcaaagaagaagatcta
tacaggaaggggaaagtggtgctgccagggtttagtgccatgcgttgcactggaaagaat
ttgattttgcagtcatga

DBGET integrated database retrieval system