KEGG   Latimeria chalumnae (coelacanth): 102359893Help
Entry
102359893         CDS       T02913                                 

Gene name
TYMP
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    102359893 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102359893 (TYMP)
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     102359893 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 486 aa AA seqDB search
MMGHSNSPQLTVLYPLGAVFFLFQPSPFMDTQKEELSIPRLIRRKRDGEELQGEEICYFV
QAVKEGTIQESQIGALLMAIWQHGMEQQEILAMIKEMMVSGTVLQWPKEWCGIVVDKHST
GGVGDKVSLPLAPALAACGYKVPMISGRGLAHTGGTLDKMESVPGFNVDQSPEQITQMLE
DVGCCIVGQADSLVPADKILYAIRDITSTVDSLPLITASIMSKKGAESLSALILDVKYGS
AALYKSIESARELAHSLVRVGKHLGICTTAVLSKMDNPIGQNIGNSLEVMESIECLKGRG
PADLRGLVTSLGAHLLYMCRKADTLQSGMEQIGRVLDNGTALLKFQAMLEAQGVQAGIAR
SLCQGNGDVDYFRVMGRAQHQEELRAEKEGVVEAIWAMPLAEMCHELGAGRTKAGTPINH
RVGIELLVSLGDHVQKGSPWIRVHRGFPALTDNQKSHLQEALVIGNGKNFTTCSRISEVI
TSESIE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgatgggacattccaacagccctcagctcactgtactgtatcccctgggggcggttttc
tttctttttcaacctagcccattcatggacacccagaaggaagagctcagtattcccaga
ctaatccggaggaaaagagatggagaagagttacaaggcgaggagatctgttactttgtc
caagcagttaaggagggaaccatccaggaaagccagataggagccctactcatggcaatc
tggcagcacggaatggagcagcaggagatcctcgcaatgatcaaggagatgatggtgtct
ggaactgtccttcagtggccgaaggaatggtgtgggatcgtggtggataagcactccacg
ggcggagtgggagacaaggtcagtctccccctggcacctgccctggctgcctgtggctac
aaggtgccaatgatcagtgggaggggcctggctcacaccggcgggaccctggataagatg
gaatctgtaccgggtttcaatgtggatcagagtcctgagcaaattacgcagatgctggag
gacgtcggctgctgtattgtcggacaggcagacagtctggtccctgcagacaaaatcctg
tacgctatcagggatatcacatctactgttgacagcctgcctctcatcacagcatccata
atgtcgaagaaaggagctgagtcgctgtccgcgctcatcctggacgtgaagtatggcagc
gctgctctctacaagagcattgaaagcgcccgagagctggctcattctctggtgagagtc
ggaaaacatctgggaatttgcaccacggctgtcctcagtaagatggacaaccccatcggc
cagaacattgggaactcgttggaggtgatggagtccattgagtgcctgaagggaagagga
cctgcggatcttcgagggcttgtcaccagtctaggagctcacctgctgtacatgtgccgg
aaggctgacacacttcagtctggaatggaacagattggaagggttctggacaacggaacg
gctctgctgaaattccaggccatgctagaagcccaaggggtgcaagctggcatcgcacgg
tcactgtgccaaggaaatggagatgtggattacttccgggtcatgggtcgtgctcagcac
caggaggagctgagggcagaaaaagaaggtgtggttgaagctatttgggctatgcctttg
gcggagatgtgccatgaactaggagcaggacggaccaaggctgggaccccgatcaaccac
agagttggcattgagctcttggttagcctgggagaccatgtgcaaaaagggtcaccctgg
atcagagttcatcgtgggtttccagcattgacagacaaccagaaatctcatctccaagag
gctttggtcattggaaatggcaagaattttaccacctgttcacgcatctcagaggtcatc
acctcagaatcaattgagtaa

DBGET integrated database retrieval system