KEGG   Latimeria chalumnae (coelacanth): 102359961Help
Entry
102359961         CDS       T02913                                 

Gene name
GYS2
Definition
glycogen synthase 2 (liver)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102359961 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102359961 (GYS2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102359961 (GYS2)
Glycosyltransferases [BR:lcm01003]
 Polysaccharide
  Storage polysaccharide
   102359961 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 705 aa AA seqDB search
MPLARSLSMTSLNELPQWEDEDLPVEDLLLFEVSWEVTNKVGGICTVIQTKAKITVDEWG
ENYVMIGPYFEHNVKTQVEMFTPQNPAIKKAMDILILNGCQVYFGRWLIEGNPYVLLFDI
HSAAWKLDKWKGEFWNACGVGLPSGDRETNDALIFGSLTAWFLKELTDELQGKKNIIVNF
HEWLAGTGLILSRFKKLPIATIFTTHATLLGRYLCAANIDFYNNLDKFNVDKEAGERQIY
HRYCIERASVHCAHVFTTVSQITAIEAEHMLKRKADVVTPNGLNVKKFSAMHEFQNLHSM
YKARIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLEALSRLNFLLQVHKND
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKEKFGKKLYEALLKGEIPDMSKI
LDRDDLTIMKRAIYATQRQTLPPVTTHNMSDDSTDPILSNIRRIGLFNNRTDRIKVVLHP
EFLSSTSPLLPLDYEEFIRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
DHVADPDAYGIYIVDRRFRSLDESCNQLTQFMYRFCQQTRRQRIIQRNRTERLSELLDWR
YLGRYYMHARHLGLSRAFPNKFKMEPIAPPRTEGFRYPRPPSVPPSPSVSLHSSPHHSEG
EDEDDDDERYDEDEEAEKDRKNIKSPFAPELVLEGERKQHGEYKN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccactagcaagatcactttcgatgacctccttaaatgaactccctcaatgggaggat
gaagatttacctgtagaagacttgttgctctttgaagtgtcttgggaagttacaaataaa
gttggtggcatctgtactgtaatccagacaaaggccaaaatcacagtggatgaatgggga
gaaaactatgttatgattggtccatattttgagcataatgtgaagacgcaggtagaaatg
tttacacctcaaaacccagcaattaaaaaagccatggacattttgatattaaatggctgt
caggtatattttggaagatggctgatagaaggcaacccatatgtattgctgtttgacata
cattcagcagcttggaagttagacaagtggaaaggggaattctggaatgcatgtggagtt
ggattaccttctggtgacagagaaactaatgatgctttaatttttggatccctgaccgcg
tggtttttaaaagagcttactgatgaacttcaagggaaaaaaaacatcattgttaatttt
catgaatggctcgcaggaactgggctaatactttcaaggtttaagaaactccccatagca
acaatctttaccactcatgctactctactggggagatacttatgtgctgccaacatagat
ttctataacaaccttgacaagtttaatgtagataaagaagcaggtgaaaggcagatttac
catcggtattgcattgagcgtgccagtgtccactgtgcacacgtctttacaacagtttct
cagatcacagccattgaggccgagcacatgttgaagagaaaagctgacgtggttactcct
aatggtttgaatgtgaagaaattttcagctatgcatgaatttcagaatctgcactccatg
tacaaggctcgtatccaagagtttgttcgaggacatttctatgggcatcttgactttaat
ctggaaaagacccttttcttcttcattgctggaagatatgaattttcaaacaaaggggta
gatatatttttggaagccttgtccagactgaacttcctcctgcaggttcacaagaatgat
gttacagtcatagtctttttcataatgcctgcaaaaacaaacaacttcaatgtggaaacc
ctaaaggggcaggcagtcagaaagcagttatgggatactgctcatactgttaaagaaaag
tttggaaagaagctctatgaagcattgttaaagggagaaattcctgatatgagcaagatc
ctcgatcgtgatgacctaacaatcatgaaaagagccatctatgcaactcagcggcaaaca
ctacctccagtaacaactcacaatatgagtgatgattccactgacccaatcctcagcaat
atcagaagaatcgggctattcaacaatcgcactgatagaatcaaggttgtcctacaccca
gagtttctttcttctacaagtccactattacccttggattatgaagagtttatcagagga
tgccatcttggggtctttccatcatactatgaaccctggggatatactcccgctgaatgt
acagtgatggggattcccagtgtaacaaccaacctttctggatttggctgcttcatgcaa
gatcatgtagctgatccagatgcctatggtatttacattgttgaccgccggtttcgttct
ctagatgagtcctgtaatcagctgacccagttcatgtatagattttgccagcagacacgt
cgtcagagaatcattcaaagaaatcgcactgagaggctttcagagctactggactggaga
tatctaggcagatactacatgcacgctagacatctaggactgagcagagcctttccaaac
aagttcaagatggaaccaatagctccaccaaggacggaaggtttccggtaccccagacct
ccttctgttccaccatctccttctgtgtctttgcattcaagtcctcaccacagtgaagga
gaagatgaggatgatgatgatgaaaggtatgatgaagatgaagaagctgaaaaagacagg
aagaacattaagtcaccatttgcacctgaattagtactggaaggggaaaggaaacagcat
ggggaatacaaaaattga

DBGET integrated database retrieval system