KEGG   Latimeria chalumnae (coelacanth): 102359961Help
Entry
102359961         CDS       T02913                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102359961 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102359961 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102359961 (GYS2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102359961 (GYS2)
Glycosyltransferases [BR:lcm01003]
 Polysaccharide
  Storage polysaccharide
   102359961 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 705 aa AA seqDB search
MPLARSLSMTSLNELPQWEDEDLPVEDLLLFEVSWEVTNKVGGICTVIQTKAKITVDEWG
ENYVMIGPYFEHNVKTQVEMFTPQNPAIKKAMDILILNGCQVYFGRWLIEGNPYVLLFDI
HSAAWKLDKWKGEFWNACGVGLPSGDRETNDALIFGSLTAWFLKELTDELQGKKNIIVNF
HEWLAGTGLILSRFKKLPIATIFTTHATLLGRYLCAANIDFYNNLDKFNVDKEAGERQIY
HRYCIERASVHCAHVFTTVSQITAIEAEHMLKRKADVVTPNGLNVKKFSAMHEFQNLHSM
YKARIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLEALSRLNFLLQVHKND
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKEKFGKKLYEALLKGEIPDMSKI
LDRDDLTIMKRAIYATQRQTLPPVTTHNMSDDSTDPILSNIRRIGLFNNRTDRIKVVLHP
EFLSSTSPLLPLDYEEFIRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
DHVADPDAYGIYIVDRRFRSLDESCNQLTQFMYRFCQQTRRQRIIQRNRTERLSELLDWR
YLGRYYMHARHLGLSRAFPNKFKMEPIAPPRTEGFRYPRPPSVPPSPSVSLHSSPHHSEG
EDEDDDDERYDEDEEAEKDRKNIKSPFAPELVLEGERKQHGEYKN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccactagcaagatcactttcgatgacctccttaaatgaactccctcaatgggaggat
gaagatttacctgtagaagacttgttgctctttgaagtgtcttgggaagttacaaataaa
gttggtggcatctgtactgtaatccagacaaaggccaaaatcacagtggatgaatgggga
gaaaactatgttatgattggtccatattttgagcataatgtgaagacgcaggtagaaatg
tttacacctcaaaacccagcaattaaaaaagccatggacattttgatattaaatggctgt
caggtatattttggaagatggctgatagaaggcaacccatatgtattgctgtttgacata
cattcagcagcttggaagttagacaagtggaaaggggaattctggaatgcatgtggagtt
ggattaccttctggtgacagagaaactaatgatgctttaatttttggatccctgaccgcg
tggtttttaaaagagcttactgatgaacttcaagggaaaaaaaacatcattgttaatttt
catgaatggctcgcaggaactgggctaatactttcaaggtttaagaaactccccatagca
acaatctttaccactcatgctactctactggggagatacttatgtgctgccaacatagat
ttctataacaaccttgacaagtttaatgtagataaagaagcaggtgaaaggcagatttac
catcggtattgcattgagcgtgccagtgtccactgtgcacacgtctttacaacagtttct
cagatcacagccattgaggccgagcacatgttgaagagaaaagctgacgtggttactcct
aatggtttgaatgtgaagaaattttcagctatgcatgaatttcagaatctgcactccatg
tacaaggctcgtatccaagagtttgttcgaggacatttctatgggcatcttgactttaat
ctggaaaagacccttttcttcttcattgctggaagatatgaattttcaaacaaaggggta
gatatatttttggaagccttgtccagactgaacttcctcctgcaggttcacaagaatgat
gttacagtcatagtctttttcataatgcctgcaaaaacaaacaacttcaatgtggaaacc
ctaaaggggcaggcagtcagaaagcagttatgggatactgctcatactgttaaagaaaag
tttggaaagaagctctatgaagcattgttaaagggagaaattcctgatatgagcaagatc
ctcgatcgtgatgacctaacaatcatgaaaagagccatctatgcaactcagcggcaaaca
ctacctccagtaacaactcacaatatgagtgatgattccactgacccaatcctcagcaat
atcagaagaatcgggctattcaacaatcgcactgatagaatcaaggttgtcctacaccca
gagtttctttcttctacaagtccactattacccttggattatgaagagtttatcagagga
tgccatcttggggtctttccatcatactatgaaccctggggatatactcccgctgaatgt
acagtgatggggattcccagtgtaacaaccaacctttctggatttggctgcttcatgcaa
gatcatgtagctgatccagatgcctatggtatttacattgttgaccgccggtttcgttct
ctagatgagtcctgtaatcagctgacccagttcatgtatagattttgccagcagacacgt
cgtcagagaatcattcaaagaaatcgcactgagaggctttcagagctactggactggaga
tatctaggcagatactacatgcacgctagacatctaggactgagcagagcctttccaaac
aagttcaagatggaaccaatagctccaccaaggacggaaggtttccggtaccccagacct
ccttctgttccaccatctccttctgtgtctttgcattcaagtcctcaccacagtgaagga
gaagatgaggatgatgatgatgaaaggtatgatgaagatgaagaagctgaaaaagacagg
aagaacattaagtcaccatttgcacctgaattagtactggaaggggaaaggaaacagcat
ggggaatacaaaaattga

DBGET integrated database retrieval system