KEGG   Latimeria chalumnae (coelacanth): 102361109Help
Entry
102361109         CDS       T02913                                 

Gene name
ELP3
Definition
(RefSeq) elongator acetyltransferase complex subunit 3
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102361109 (ELP3)
Transfer RNA biogenesis [BR:lcm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102361109 (ELP3)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102361109 (ELP3)
   HAT complexes
    Elongator complex
     102361109 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 102361109
NCBI-ProteinID: XP_006003133
Ensembl: ENSLACG00000006861
Position
Un
AA seq 550 aa AA seqDB search
MKQKKKGDLSHAELMMMTIADIIKQLVEAHEQGKDTNLNKLKTKTSAKYGLSAQPRLVDI
IAAVPPRYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALAED
YRDFFIRSLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLERDIEQ
FIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYKSYSPSMLVELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQV
ELIRRDYVASGGWETFLSYEDPEQDILIGLLRLRKCSEESFRPELKGGVSIVRELHVYGS
VVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSWKIAVISGVGTRNYYRKIGYELEGP
YMVKRLDCFY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaagaagaaaggagatctcagccatgcagagctcatgatgatgaccattgcg
gatattatcaagcagctggttgaggctcacgaacaaggaaaggacaccaacctgaacaag
ttgaaaaccaaaacctctgccaagtacgggctgtctgcgcagcctcgccttgtcgacatc
atcgccgcggtgccgccgcggtacaggaaagtgctggttccaaaactcaaagcgaagcca
atcaggacggccagtgggattgctgtagttgcggtgatgtgcaaacctcatcgatgccct
cacatcaactttactgggaacatctgtgtgtattgccccggagggcctgattcagacttc
gagtactcaacgcaatcttacacgggatatgagccgacctcaatgagggctatccgtgcc
aggtacgacccctacctgcagacaagacaccgagtagaacagctgaaacagctgggccac
agcgtggataaagtggagttcattgtgatgggcggcaccttcatggcgctggcagaggac
tacagggatttcttcatccggagtttgcacgacgctctgtccggacacacctccaacaac
gtggccgaggctgtcaggtactcggagcggagtaataccaagtgcgtgggcataacgatt
gagacaaggccagattactgcctgaaacgccacctcagcgacatgttgtcatatggctgc
acgcggctggagatcggagtgcagagtgtttacgaagatgtggccagagacaccaacagg
ggccacacagtcaaggctgtctgcgagtcattccacctggcaaaggatgctgggtttaaa
gtggtagcgcacatgatgcctgacctgcccaacatgggactggagagggatatcgagcag
ttcattgagttttttgagaaccctgccttccgcccggacggcatgaagctgtacccgacg
ctagtgatccgaggcactggtctgtacgaactctggaagacaggcagatataagagttac
tcacccagtatgctggtggagctagttgcgcggatccttgcgctggtgccaccatggacg
cgagtctacagggttcagagagatatcccaatgccactggtcagttcaggagtggaacat
ggtaaccttagggagctggccctagccaggatgaaagacttagggacagagtgtcgggac
gtgaggactcgagaagttggaattcaagagattcatcacaaagtgagaccgtatcaggtg
gagttgattcgaagggattacgtagcaagtgggggatgggagaccttcctgtcatacgag
gacccagaacaggacatcctgattggcctgctgcgtctgcgaaaatgctcggaggagtcg
tttcggcccgagttaaaaggcggcgtctcgatcgtccgggagctgcacgtgtacggcagt
gtggtgcccatcagcagccgggacccttccaaattccagcaccaggggtttggtatgttg
ctaatggaggaggctgaacggattgcgagagaagagcatggatcgtggaaaattgctgtc
atttcaggagttggaacgaggaattactacaggaagattggttacgagctggaggggccc
tacatggtgaagagattggattgtttttattga

DBGET integrated database retrieval system