KEGG   Latimeria chalumnae (coelacanth): 102361109Help
Entry
102361109         CDS       T02913                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102361109
Transfer RNA biogenesis [BR:lcm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102361109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 550 aa AA seqDB search
MKQKKKGDLSHAELMMMTIADIIKQLVEAHEQGKDTNLNKLKTKTSAKYGLSAQPRLVDI
IAAVPPRYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALAED
YRDFFIRSLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLERDIEQ
FIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYKSYSPSMLVELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQV
ELIRRDYVASGGWETFLSYEDPEQDILIGLLRLRKCSEESFRPELKGGVSIVRELHVYGS
VVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSWKIAVISGVGTRNYYRKIGYELEGP
YMVKRLDCFY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaagaagaaaggagatctcagccatgcagagctcatgatgatgaccattgcg
gatattatcaagcagctggttgaggctcacgaacaaggaaaggacaccaacctgaacaag
ttgaaaaccaaaacctctgccaagtacgggctgtctgcgcagcctcgccttgtcgacatc
atcgccgcggtgccgccgcggtacaggaaagtgctggttccaaaactcaaagcgaagcca
atcaggacggccagtgggattgctgtagttgcggtgatgtgcaaacctcatcgatgccct
cacatcaactttactgggaacatctgtgtgtattgccccggagggcctgattcagacttc
gagtactcaacgcaatcttacacgggatatgagccgacctcaatgagggctatccgtgcc
aggtacgacccctacctgcagacaagacaccgagtagaacagctgaaacagctgggccac
agcgtggataaagtggagttcattgtgatgggcggcaccttcatggcgctggcagaggac
tacagggatttcttcatccggagtttgcacgacgctctgtccggacacacctccaacaac
gtggccgaggctgtcaggtactcggagcggagtaataccaagtgcgtgggcataacgatt
gagacaaggccagattactgcctgaaacgccacctcagcgacatgttgtcatatggctgc
acgcggctggagatcggagtgcagagtgtttacgaagatgtggccagagacaccaacagg
ggccacacagtcaaggctgtctgcgagtcattccacctggcaaaggatgctgggtttaaa
gtggtagcgcacatgatgcctgacctgcccaacatgggactggagagggatatcgagcag
ttcattgagttttttgagaaccctgccttccgcccggacggcatgaagctgtacccgacg
ctagtgatccgaggcactggtctgtacgaactctggaagacaggcagatataagagttac
tcacccagtatgctggtggagctagttgcgcggatccttgcgctggtgccaccatggacg
cgagtctacagggttcagagagatatcccaatgccactggtcagttcaggagtggaacat
ggtaaccttagggagctggccctagccaggatgaaagacttagggacagagtgtcgggac
gtgaggactcgagaagttggaattcaagagattcatcacaaagtgagaccgtatcaggtg
gagttgattcgaagggattacgtagcaagtgggggatgggagaccttcctgtcatacgag
gacccagaacaggacatcctgattggcctgctgcgtctgcgaaaatgctcggaggagtcg
tttcggcccgagttaaaaggcggcgtctcgatcgtccgggagctgcacgtgtacggcagt
gtggtgcccatcagcagccgggacccttccaaattccagcaccaggggtttggtatgttg
ctaatggaggaggctgaacggattgcgagagaagagcatggatcgtggaaaattgctgtc
atttcaggagttggaacgaggaattactacaggaagattggttacgagctggaggggccc
tacatggtgaagagattggattgtttttattga

DBGET integrated database retrieval system