KEGG   Latimeria chalumnae (coelacanth): 102361862Help
Entry
102361862         CDS       T02913                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102361862 (PTGS1)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102361862 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 491 aa AA seqDB search
MRVVLTVRSNLIPSPPTYNSKYGYINWEAYSNITYFTRILPPVPDDCPTPMGTKGKMTLP
DAQIIAEKLLLRKKFIPSPQGTNLMFAFFAQHFTHQFFKTHGRLGRGFTKALGHGVDLGH
VYGDTLENQHKLRLFKDGKMKYQIVNGEMYPPLVASAPVNMTYPRDIPMNQRLATGQEVF
GLLPGLLTYATLWLREHNRVCDILKEEHPTWNDEQLFQTTRLILIGETIKIIIEDYVQHL
SGYFLKLKFDPEMLFGVQFQYRNRIAVEFNQLYHWHPLMPDSFIIKGDEYEYSSFLFNTS
ILMDYGVETLVEAFSIQPAGRIGGGHNINSKILHVAVGVIRESRLLRLQPFNEYRKRFGL
RPYESFQELTGEEEMAAELENLYGDIDAMEFYPALLLEKPYPGNIFGESMVEMGAPFSLK
GLLGNPICSPEYWKPSTFGGKTGFDIINTASLSKLVCLNVKKCSYVGFSVPEGIRKCNKL
KPPEKKPSTEL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgttctaacagttcgatctaatttgattccaagtccaccaacatataattct
aagtatggctacattaactgggaagcatattccaatataacctacttcactcgaatactt
ccacctgtaccagatgactgtccgactccaatgggaactaaaggaaaaatgacgcttcct
gatgctcagattattgcagaaaagcttctcttacgaaagaagtttattccatctcctcag
gggacaaacttgatgtttgcgttttttgctcagcattttacccatcagttctttaagact
catggaagactgggtcgtggatttacaaaagctttgggtcatggagtggatcttggacat
gtatatggggacacactggaaaatcagcataaactaaggctttttaaggatggaaaaatg
aagtaccagatagtaaatggagaaatgtacccaccacttgtagccagtgcaccagtcaac
atgacttaccctcgtgacattcccatgaaccaacgcttagctactggtcaggaggttttc
ggtctgcttccaggattgttgacatatgctacactttggttacgagaacacaatagagtc
tgtgatattttgaaagaagaacatccaacctggaatgatgaacaattgtttcaaactacc
agacttattcttattggtgagactataaagattataattgaagattatgttcagcatctt
agtggttactttctaaagctgaagtttgatcctgagatgttgtttggggtgcagtttcag
taccgaaaccggattgctgtggagtttaaccagttgtaccactggcacccgctgatgcct
gacagttttattattaagggagatgagtacgagtacagcagcttcctctttaatacttcc
attcttatggattatggtgtggaaacgctggtggaagctttttcaatacaacctgcaggg
aggatcggtggtggacataatataaattcaaaaattctgcatgtggcagttggggttatt
agggagtcaagactgctgagacttcagccatttaatgaatacaggaagcgatttggcctg
aggccatacgagtcttttcaggaacttactggagaggaagagatggcagctgaacttgag
aacctgtatggagatattgatgctatggaattttatcctgccttgctgctggaaaaacct
tatcctggtaacatctttggagaaagcatggtggaaatgggagctcccttttcacttaaa
ggccttctgggcaaccctatctgttcccctgaatactggaaacctagcacttttggggga
aaaacaggatttgacatcatcaatacagcttcacttagcaaactagtgtgccttaatgtg
aaaaaatgttcatatgttggttttagtgtcccagaaggtatacgtaagtgtaataaactt
aaacctccagagaagaagccttcaactgagctctag

DBGET integrated database retrieval system