KEGG   Latimeria chalumnae (coelacanth): 102362575Help
Entry
102362575         CDS       T02913                                 

Definition
(RefSeq) lysozyme C-like
  KO
K13915  
lysozyme C [EC:3.2.1.17]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102362575
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102362575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 125 aa AA seqDB search
MMTSLMTLCAPGGSFKNPMAWMHGVCLAYYESTYRTHVTHYNHNDSSTDYGILQINSRWW
CEDGTPRSKNLCRIDCNKFTDEDITDDLQCAKRIVQDPKGLGAWNGWKDNCKGKDVSEFV
EGCGV
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatgacatcactgatgaccttgtgtgcgccaggagggtccttcaagaacccgatggca
tggatgcatggggtgtgtctggcttactatgagagcacctaccgtactcatgtaacccac
tataaccacaacgacagcagtacagactatggaatactccagataaacagtcgctggtgg
tgtgaggatgggactcctcgcagcaagaacctctgtaggatagactgtaataaatttact
gatgaggacatcactgatgaccttcagtgcgccaagaggatcgttcaagaccccaaaggc
ctgggcgcatggaatggctggaaggacaactgcaaaggaaaagatgtcagtgagtttgtg
gaaggttgtggagtttaa

DBGET integrated database retrieval system