KEGG   Latimeria chalumnae (coelacanth): 102362669Help
Entry
102362669         CDS       T02913                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    102362669 (DHCR7)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     102362669 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 478 aa AA seqDB search
MATSQVSDVTKRRVKSDSNGLDSKEKEQMGQWGRAWKVDWFSLASVIFLLCFAPFIVFYF
VMSCDQYQCALMGPGADLYTGKAHLIDLWNRAPSLSWTAVKIYSVWVAFQVLLYTFVPDV
CHKLLPGYVGGIQEGARTPAGRVNKYEINGLQAWIITHALWWANAYYFHWFSPTIIFDNW
ISLLWCANILGYLVSTFAMVKAYIFPTNEKDCKFTGNFFYDYMMGIEFNPRVGKWFDFKL
FFNGRPGIVAWTLINLSYAAKQRELYGQVTNSMILVNVLQAVYVLDFFWNEAWYLKTIDI
CHDHFGWYLGWGDCVWLPYLYTLQGLYLVYNPIQLSTSNAVGVLLLGLVGYYIFRMTNHQ
KDLFRRTNGSCKIWGRSPEYIECTYTSVDGKEHQSKLLISGFWGLARHFNYTGDLMGSLA
YCLTCGFQHLLPYFYIVYMTILLVHRCIRDEHRCSSKYGKDWKHYTSAVPYRLLPGIF
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcccaggtatcggatgtcactaaaagacgagtcaaaagtgattcaaatggc
ttggatagcaaggaaaaggagcagatgggtcaatggggaagagcctggaaagtggactgg
ttctccctggcgagtgtaattttcctgttgtgctttgctcctttcattgtattttacttt
gtgatgtcctgtgatcagtaccagtgtgcactgatggggcccggtgcagatctgtacacg
gggaaagcccatctgattgacctctggaatcgcgctccttctctcagctggactgcagta
aagatttactccgtttgggttgcattccaggtgcttctgtatacgtttgtgcctgatgtt
tgtcacaagctgctgcctggttatgttggtggaatacaggaaggtgctcggacacccgct
ggcagagttaataaatatgagatcaatggacttcaagcctggatcattactcatgctctc
tggtgggctaatgcttattattttcattggttctctccaaccatcatatttgataactgg
atctccttgttatggtgtgccaacatcttgggctatttggtttccacatttgcaatggta
aaggcctatatcttccccaccaatgaaaaggactgcaaatttactggaaacttcttctac
gattatatgatggggattgaatttaaccctcgagttggaaagtggtttgactttaagctc
ttctttaacggccgtcctggcattgtagcctggactcttattaacctatcctatgccgct
aaacagagggagctgtatggtcaagtgacaaactccatgatcctcgttaatgttcttcag
gctgtgtatgtcctggacttcttttggaatgaagcttggtatctgaagaccattgatatc
tgtcatgaccactttgggtggtacttgggttggggagattgcgtctggctgccttacctc
tacacgctgcagggcctgtatcttgtctacaatccaatacagctctccacatccaatgct
gttggagttctcctcttgggtctggttggctactacatcttcagaatgaccaatcatcaa
aaagatcttttccgtcgcaccaatggcagctgcaagatttggggtagaagcccagagtac
attgagtgcacctatacttccgtggatggaaaggagcaccagagtaaactgttaatctct
ggattctgggggttggcgcgtcattttaactacacgggagatctgatgggttcgcttgcc
tactgcttgacctgtggctttcaacacctactgccttacttctacattgtttacatgact
atcctgttggtccatcgctgtatcagggacgagcatcggtgttccagcaaatatggcaag
gactggaagcactacactagtgctgttccataccgactcttaccaggaattttttaa

DBGET integrated database retrieval system