KEGG   Latimeria chalumnae (coelacanth): 102362871Help
Entry
102362871         CDS       T02913                                 

Gene name
GBA2
Definition
(RefSeq) glucosidase, beta (bile acid) 2
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102362871 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102362871 (GBA2)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102362871 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 863 aa AA seqDB search
MEASSGASYPDLMQKYTGSSRGVGVPEFGWRICLAHEFKEKRKPFQASNVSLSNIVNHFG
LGIRYLIWWHRKTRVEKKAPFIDMFNSLPLRQIYGAPLGGFGGGTITRGWRGEFCRWQLN
PGMYHYKSVITDQFTVCVRKNGQTIFQQVLSMERPHKLQSWNWGFCGTYAFYHALYPRAW
SVYELPGQGLTLTCRQISPIIPHDYKDTSLPVGVFVWSIENQNTEELDVSIMFTLRNGMG
TKEDEKGGHWNEPFHLEKEGEEVAGILLHHCIPVNPYTMAISARAKDGVAVSHYTAFDPS
GMGLEVWRDLMQDGRLDSPAGKGPKTHKGRKTAAAVAATCTVPGKGQNTLEFCLAWDMPT
IYFGAREKQHLRRYARFFGSRGDAAPALCHYALTCFEDWERRIEEWQHPILNNRDLPSWY
KSALFNELYFLSDGGTVWVEVPDDTDITGGIRSKEGGLPALPTVLKEFGRFAYLEGQEYR
MYNTYDVHFYASFALIMLWPQLELSLQYDIAAAVVKEDTTQRVHLMSGRMSQVNSKNVVP
HDIGDPEDEPWERVNAYLIHDTADWKDLNLKFVLQVYRDYHLTHDDLYLQDMWPVCQAVM
ESELKFDTDGDGLIENSGYADQTYDGWAVTGPSAYCGGLWLASVCVMCKMAHLLDDTVVL
RKYTAILQKGKEAFERILWNGKYYNYDNSGKCYSNSVMSDQCAGQWFLRACDLGDGEFEA
FPKSHILSALKTIYDLNVMSFANGTMGAVNGMRPDGHPDTSSVQSDEVWIGVVYGLAATM
IQEGMMKEGFKTAEGCYRTVWERLGMAFQTPEAYCQKNIFRSLAYMRPLSVWSMQLALEK
LQPTPNGLEDKPRSSSSTGSETL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttcttcgggtgccagctatccggatctgatgcagaagtacacggggtcctcc
agaggggtcggcgtgcccgagttcggctggaggatctgcctggctcacgagtttaaagag
aagagaaaacccttccaggcctcgaatgtgtcgctgtccaacatcgtcaatcactttggc
ctcggaatacggtacctgatttggtggcatcggaagacgcgggtggagaagaaggcacca
tttattgacatgttcaactcactgccacttcgccagatttacggagctccacttggcggc
tttgggggaggtaccatcacccgaggttggcggggggagttctgtcgctggcagctgaac
cctggaatgtaccattacaaaagtgtaatcactgatcagttcacagtgtgtgtgcggaag
aacgggcagacaatcttccagcaggtgctgtccatggagagaccccacaagctacaaagc
tggaactggggtttctgtgggacctacgctttctaccatgccctgtacccccgcgcctgg
agcgtgtacgagctccccggacagggcctcacgctcacctgcaggcagatttctcccatc
atacctcatgattacaaggatacgagtttacctgtgggcgtattcgtctggagcatagag
aatcagaacactgaggagctggacgtgtcaatcatgttcaccctgaggaatgggatgggc
accaaggaagatgagaaagggggacactggaacgaaccattccacctggaaaaggaggga
gaggaggtggctggaatcctgctgcaccactgcatccccgtcaacccgtacacaatggcg
atttccgccagggcaaaggacggagtagcagtttcacactacacagcgttcgacccctcg
gggatgggcctcgaggtgtggagggacctcatgcaggacggcagactggactctccagca
ggtaagggccccaagacccataaaggaaggaagaccgcagcagccgttgcagcaacctgt
acggttcctggtaaaggacaaaatacactggagttctgtctggcctgggatatgcccacc
atctactttggggctagagaaaagcagcacttgaggcggtacgcacgattttttgggagt
aggggtgatgcagccccggcgctctgtcactacgcactgacttgttttgaagattgggag
cgcaggatagaggagtggcagcaccccatcttaaacaacagggatctccctagctggtac
aagtctgccctgttcaacgaactctacttcctgtcggacggaggtactgtttgggtcgag
gttccggatgataccgatatcaccggtgggatacgttccaaggaggggggcctccctgct
ctcccaactgtcttgaaggaatttggaagatttgcttacttggaaggccaggagtatcgg
atgtataacacgtacgacgtgcatttttacgcttcctttgcgctgatcatgttgtggccg
cagctggagctcagcctgcagtatgatatagctgcagcagtggtgaaagaagatacgacc
cagagggtccatctcatgagcggccggatgtcccaggtgaattcgaagaatgttgtcccc
catgatatcggagacccagaggatgagccgtgggagcgagtgaatgcctatctaatccac
gacacggccgactggaaggacctgaacctcaaatttgtgctgcaggtttaccgggattat
cacctcacacacgacgacctctacctccaggacatgtggccagtctgccaggctgtgatg
gagtcggagctgaagtttgatacagatggagatggactgattgaaaactccggatatgca
gatcagacgtacgacggctgggcagtgacaggacccagtgcgtactgtgggggtctctgg
ctggcatcagtctgtgtgatgtgtaagatggcgcatctcctggatgacaccgtggttctc
cggaagtacactgccatcctacagaaagggaaggaagccttcgagaggatactctggaac
ggtaaatattacaactacgacaacagcgggaaatgctactccaacagcgtgatgtcagat
cagtgtgctggacagtggtttctgcgcgcttgcgaccttggtgacggagagtttgaggct
tttccaaaatcccatattttgagtgcgctgaagacaatctatgacctcaacgtcatgagc
tttgctaatggcactatgggagcagtgaacggaatgaggcctgatgggcatccagacacc
tccagcgtccaatcagatgaggtgtggattggggttgtctatggactggctgccaccatg
attcaggagggtatgatgaaggagggatttaagacagctgagggctgttatcggacggta
tgggagcgtcttgggatggctttccagacgccagaggcttactgtcagaagaacattttt
cgctcactggcctacatgaggccactcagcgtctggagcatgcaattggcattggagaaa
ctgcagccgactcctaacggtttggaggacaagccgaggagcagctcttcaacgggcagt
gaaacactgtga

DBGET integrated database retrieval system