KEGG   Latimeria chalumnae (coelacanth): 102362907Help
Entry
102362907         CDS       T02913                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102362907
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102362907
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102362907
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102362907
  Exosomal proteins of breast milk
   102362907
Heparan sulfate/heparin binding proteins [BR:lcm00536]
 Enzymes (General comment) Variety
  102362907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 446 aa AA seqDB search
MKPITLLLLLLTLPVLIPATQPSENDLNSQHFDAEPEEFNSVHTKFSLRTPLDPEEDVCY
IVPGRADTLNKCNFNTTTKTFLVIHGWTVSGMFESWISKMVAALYKREHDANVIVVDWLN
LAHQHYPIAAQNTKLVGQDIAQFIDWIKEKINFPLDNLHLIGYSLGAHVAGFAGSHTANR
VGRITGLDPAGPVFEQAHAHARLSPDDAAFVDVLHTFTRGSLGLSIGIQQPVGHVDIYPN
GGSFQPGCNLRGALESIAKHGIFGKKQTGCICCNCLGKLAPADSKGLTFRKFFFPVYHYQ
LKIHFTSKHDHTEIEPSLFISLYGTEGEIEGLEIKVEEKIVPNRTHSFLLVTEVFIGELL
MMTFKWWEVSEWSSASLMQMLSSWWSGQSSPAETEIHNIHVLSGETQQKMVFCPKHSSAS
PKIQEVTFVRCQDYWSKSQKRLSRKH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatcacgctgctgctgcttctcctgactctgcccgtcctcattccggccacc
cagccatccgaaaatgacctcaattcccaacattttgatgctgaaccagaagaatttaac
tccgtccacactaagttttccctgcgcaccccattggacccagaagaagacgtctgttac
attgtcccaggccgagcagatactctcaacaaatgtaacttcaacaccaccacaaaaaca
tttctagtcattcacggctggacagtcagcggtatgttcgagagctggatttccaaaatg
gtcgcagccctttacaagagagagcatgatgccaatgttattgtagtggattggctgaac
cttgctcaccagcattatccaattgcagcccagaatactaaactggtggggcaggatatt
gcccagtttattgactggataaaggagaaaattaactttcccctggacaatcttcacttg
atcgggtacagccttggtgcccacgtggctgggttcgcaggaagccacacagccaacaga
gtgggcagaataacaggtctagatccagcagggccggtgtttgaacaggcacacgctcac
gcccgcctttctccagatgatgctgcctttgttgacgttcttcacactttcacccggggc
tcactggggctaagtatcgggattcaacagcctgttggccatgtggacatttatcccaat
ggtgggagcttccagcccggctgtaacctgcgtggagcgctggaaagtattgccaaacat
ggaattttcggtaagaaacaaacaggatgtatctgctgtaactgtttaggcaaattggca
ccagctgacagtaaaggtttaacattcagaaaatttttttttccagtttatcactatcag
ttgaagatccatttcaccagcaaacacgaccatacagaaatcgaaccttctctcttcatc
tcactttatggaactgagggagaaatagaagggctggaaattaaagtagaagagaaaatc
gttcccaatagaacacattccttcctgctggtcacggaagtcttcatcggggagctgctg
atgatgacgtttaagtggtgggaagtgtctgagtggtcttcagcatccctcatgcagatg
ctgtcctcctggtggtcaggtcaaagctcccctgcagaaactgagatccacaatattcat
gtgttgtcgggagaaacccagcagaagatggtattctgtcctaaacattcttctgcatcc
cccaaaattcaggaggtcacatttgtccggtgtcaggactactggagcaaatcacagaaa
aggctctccaggaaacattga

  All links  
No link information was found.   
DBGET integrated database retrieval system