KEGG   Latimeria chalumnae (coelacanth): 102362971Help
Entry
102362971         CDS       T02913                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102362971
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102362971
   04370 VEGF signaling pathway
    102362971
   04068 FoxO signaling pathway
    102362971
   04070 Phosphatidylinositol signaling system
    102362971
   04150 mTOR signaling pathway
    102362971
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102362971
  Cell growth and death
   04210 Apoptosis
    102362971
  Cellular community
   04510 Focal adhesion
    102362971
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102362971
  Endocrine system
   04910 Insulin signaling pathway
    102362971
   04914 Progesterone-mediated oocyte maturation
    102362971
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102362971
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    102362971
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102362971
Membrane trafficking [BR:lcm04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102362971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1081 aa AA seqDB search
MEIPETNSQMKLPALQCRNSNQCNDFLGDLSPKVILSFICVLPTKKPNDGVNEVVTVEIS
AHSTVRNLRLLIWMQARDISCQKEFYKIVDPAHCKLLYQKEKNWYEIYDDYQTLDSIRYW
RYMGMEKGQIYVHSKLKETKEQEDFQKRLTYLIGYDIGIMSFHGIDELSFARRKLASPRQ
TEIKQRDPWLYAMEPWITSVPFPENIKAWIGEELVVVIYYMGESNKMKVNINHTPSAIAE
CCVQRLIDKDIPVGKKEQDLVLKVCGREEYLTGDRPLVNFLWIRHCLKSKQEVHLSLIPV
PSFEDDDVTTEDWPLVDEFTGLTGTHENLQLGNQESDEITMISLWDCARKFRMKIIGIDI
PNLPTKAPQQVYIEASILHGRNILSSVISKIMPFTEEVIWNSWLEFNTLVKNLPKGSKLH
LSVNGIDNEYGPLKESKSSCQGFKDSDALKNKSKLLYFVNILLIDHRSLLQQGEHVLHMW
PYQMQEAGLFTNEAERLSSKTNPEIETSMAISIIFDSYCFPLALPYSKTSKSSSFSRPST
YQHQSKSKSMEESMLPNPVTVSGKESLRRFSEESARYGTSLPRFLSTINWGDMEAVQDLH
WLLQHWDPHNLDIVIALELLSINFADEKIRKMSVDRLEELQNDELMRYLLQLVQALKFEP
YHDSALARFLIRRALRSKRIGHFFFWYLRSEITGSPYFCDHFAVILEAYLMGCGKSMLEG
FSTQVQLVECLHQVVTDIKKIIPEESNLPASAAAQLQERLKMADLPQDFLVPFDPRIKAG
TILLNNCKIMASKKKPLWLEFTCSETEAINTPPVGIIFKHGDDLRQDMLIIQTLVVMDSI
WQENSLDLNLIPYGCISTGYRIGMIEIVRDAKTIATVQRSKGGTLGAFKNDALYDWLKSK
CKIEEMHYQALERFVTSCAGYCVATYVLGIGDRHNDNIMITEYGNLFHIDFGHILGNTKR
FLGMNRERVPFVLTPDFLFVMGRVNRKSSLYFQRFKDICIQAYQALRCHSNLLITLFSLM
MLTRIPELSCTRDIEYLKEALALGRDDQSAKDHFLNQISICENLDWTVQTNWWIHMVMGM
K
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcccggaaactaattctcagatgaagctaccagcattgcagtgcagaaatagt
aatcagtgcaatgattttctaggtgatttaagcccaaaagttattctgtccttcatttgt
gtgttgccaacaaaaaagcccaatgatggtgtcaatgaagttgttacagttgaaatttca
gcccattcaactgtaagaaatctacgactgcttatatggatgcaggcaagggatattagt
tgtcaaaaggaattttataagattgtagatcctgcacactgtaagctactttaccaaaag
gaaaagaattggtatgaaatatatgacgactatcaaactttggattccattagatactgg
agatatatgggcatggagaaaggtcagatttatgtacacagtaaactgaaagagacaaag
gaacaggaagacttccagaaaagactgacatacctaattgggtatgacattggtataatg
agcttccatggtattgatgagcttagttttgctcgtaggaaactggcttccccaagacag
acagagatcaagcaaagagacccttggttatatgccatggaaccctggataacatctgtc
cctttcccagagaatataaaagcttggattggtgaagaactagttgttgtgatctattac
atgggggagagtaataaaatgaaagtcaacataaatcatactccttcagctatagctgag
tgctgtgttcagaggctgattgacaaggacattcctgtaggaaaaaaggaacaggattta
gtcttgaaagtctgtgggagagaagaatatctcacaggggacagacctctggtaaacttt
ctttggataagacactgcttaaaaagcaagcaggaagttcacttgtccttaataccagtg
ccttcttttgaagatgatgatgtcacaactgaagattggccattggtagatgaatttact
ggactcactggtactcatgaaaacctacaactgggaaatcaggaaagtgatgagattaca
atgatatctctctgggactgtgcaagaaagttcagaatgaaaatcattggcatagacata
cctaatttgcccactaaagctcctcagcaggtctacattgaagcaagtattttacatgga
agaaatatcttgtcctctgtcatctcaaagatcatgccattcactgaagaagtaatttgg
aattcttggctagagttcaatactttggtcaaaaaccttccaaagggatcaaaactgcac
ctttcagtaaatgggatagacaatgaatatggtcccttgaaagagagcaagtcatcatgc
cagggctttaaagatagcgatgcactaaagaataaaagcaaactcctgtattttgtcaat
attctattgattgaccacaggtctttacttcagcaaggagaacatgttcttcacatgtgg
ccttaccaaatgcaagaggcaggtttgttcaccaatgaggctgaaagattatcctctaaa
actaaccctgaaatcgaaacctccatggccatcagcattatatttgactcttactgtttc
cccttggcccttccgtacagcaagacgtccaagtctagttccttcagtcgaccatccaca
tatcagcatcaatccaaatcaaagagcatggaagaaagcatgctcccaaatccagttact
gtttcaggaaaagaatccctcagaagattttctgaagaaagtgctcgctatggcacctct
ttaccaaggtttttgagcaccattaattggggagatatggaggcagtgcaggatcttcat
tggttgcttcagcattgggatccccataatttggatattgtaattgcactggagcttctc
agtattaactttgcagatgagaagatcagaaaaatgtctgtggacaggctggaagaactg
caaaatgatgagttgatgagatacctgttgcaactagtacaggctctgaagtttgaacct
taccatgacagtgcacttgccaggtttcttatccgtagagctctgaggagtaaaaggatt
ggccatttctttttctggtacctacggagtgagatcacaggttctccatatttctgtgac
cactttgccgtgattcttgaagcatatctgatgggctgtgggaagtccatgctggaaggc
ttttctactcaggttcagttggtagaatgcctgcatcaggtggttacagacatcaaaaag
attatccctgaggaaagtaacctccctgccagcgctgccgctcagctccaagaaagatta
aaaatggctgacctaccccaggacttcctggtaccattcgatccaaggatcaaagcagga
actattctgctgaataactgcaaaatcatggcctccaaaaagaagcccttgtggttagag
tttacctgcagtgagactgaagcaatcaacactccacctgttggtattatcttcaaacat
ggagacgacttacgccaggatatgcttatcattcagacactggtagtaatggactccatt
tggcaggagaactcacttgatttgaacttgataccatatggatgcatttctactgggtac
cggataggaatgattgaaattgttcgagatgctaaaaccatagccacagtgcagaggagt
aaaggcgggactcttggggcctttaagaacgacgccctttacgactggctcaagagcaag
tgcaaaattgaggaaatgcattatcaagccttggagaggtttgtcacttcctgtgctggt
tactgtgttgcaacttatgtccttggaattggagatcgccacaatgataacatcatgata
actgagtatggcaacttgttccacattgactttggtcacatcctggggaacaccaagagg
tttctgggaatgaatcgagaacgagttccatttgtgcttactcctgacttcctgtttgtg
atgggaagagttaacaggaaatcaagcctctacttccaaagattcaaagacatctgtatc
caggcgtaccaagctctccgctgtcactccaacctactgattaccctcttctctctcatg
atgctgacaaggatacctgagctgtcatgcactcgggatattgagtacctgaaggaggcg
ctagcacttggaagggatgaccaatcagcgaaggaccacttcctaaaccagattagcatc
tgtgaaaacctagactggacagtccagaccaactggtggattcatatggtcatgggaatg
aagtag

DBGET integrated database retrieval system