KEGG   Latimeria chalumnae (coelacanth): 102363083Help
Entry
102363083         CDS       T02913                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
lcm  Latimeria chalumnae (coelacanth)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 681 aa AA seqDB search
MSESSDAEGRKPKAVSHLGRSSNPPDISNAAEDTVPEFETFGGFSPRGLPPLQDYLEVWR
VNVLKNPEEINKKEHRTDKFICRNLVVRRGQPFQMKITFNRAYNPETDVVWLDILIGRYP
DVRKSTWIQVRLNQELEKGKWGTKVVESIDNNVTLSVTSSSDCIVGKFRMYIAVYTSFGI
RRTARDRDTDIYVLFNPWSKGAFGDMEKRRGDMHKKKMRINTINSRDDDGVIVGNWTDNY
SYGLAPTAWTGSGDILLQYLSSGASVCYGQCWVFAAVLNTFLRCLGIPGRVVTNFYSAHD
NDGNLVMDVVLDEDGKTNKKLTKDTVWNFHCWNECWMARSDLPAGFGGWQVIDATPQETS
EGTYRCGPASVHAVKHGHVFFPYDAPFVFAEVNSDIVYWKRMKDGTRTVVKIDSCHIGKM
ILTKEVGSDERKDITELYKFPEGSNEERLALESAMKYGAKKEKTTSPFPVDVYMEVYTEK
NVTISNDVKLTLEFRNNSQEGRAINVFIVGYIVFYTGVKKDAFMDQTLSVVVEPGYFKNV
DVHVKAKDYMSHLVEQASLHFIVTARVNETTQILTAQCVVPLRSFKLNLKIDGKPELGNQ
MSVTVEFQNPLKKPLENVSVRLEGVGLMRTKIKEYSTIPMNESIKWTEMFVPAKPGLRKM
IASLDCVALRQVYGEIQIMIN
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccagcgatgcagaggggaggaagccgaaggctgtgtctcacctgggccgt
agctctaacccacctgatatctcaaatgcagctgaggacactgtgcctgaatttgagacc
tttgggggttttagtcccagagggctacctcctttacaagattaccttgaagtatggagg
gtgaatgtgctgaagaatccagaagagattaacaagaaagagcaccgcactgacaagttc
atctgccgtaacctggtagtgcgacgtgggcagccatttcagatgaagattacgtttaac
cgggcttacaatccagaaactgatgtggtctggctggacatcttaataggtcgatatcca
gatgtcaggaaaagcacttggatccaagtaaggttgaaccaagagttggaaaaaggtaaa
tggggcaccaaggttgtggagagcatagacaacaatgtaaccttgtctgtcacgtccagc
tcagactgcattgtgggaaagttccggatgtatattgctgtctacacatcttttggcatt
cgaagaacagctagagatcgagacacagatatatatgtactctttaacccctggtctaaa
ggtgcctttggggacatggaaaaaagaagaggagatatgcacaaaaagaaaatgaggata
aacacaattaattctagagatgatgatggagttattgttgggaactggactgataattac
agctatggacttgcgcccactgcctggactggtagtggggatatcctactgcagtatcta
agttctggtgcatcagtgtgctatggacaatgctgggtctttgctgcggtcttgaataca
tttctgcggtgcttggggatacctgggagagtagttaccaacttctattcggctcacgat
aacgatggtaacttggtaatggatgttgttctggatgaagatggaaaaacaaacaaaaag
ttgactaaggataccgtttggaatttccattgctggaatgagtgctggatggctcgatct
gatttaccagcaggctttggtggatggcaagttattgatgcaactcctcaagaaacaagt
gaaggcacgtacaggtgtggacctgcttcagttcatgctgtcaaacatgggcacgttttc
tttccatacgatgctccatttgtttttgcagaggtcaacagtgatattgtttattggaag
agaatgaaagatgggaccagaactgtggttaagattgacagttgccacattggaaaaatg
attctgaccaaagaagttgggagtgatgaaagaaaggacattactgagctgtataagttc
ccagaaggctccaatgaagagagactggcacttgagtcagcaatgaagtatggtgctaag
aaggaaaagactacatctccgtttccagttgatgtttacatggaggtgtatacagaaaag
aacgtcacaatcagcaacgatgtcaaactcaccttagagttccgaaacaacagccaagaa
ggccgggcaataaatgtcttcattgttgggtacatagtgttttatacaggagtcaaaaag
gatgcattcatggatcagaccctctctgtggttgtggagcctggctattttaagaatgtg
gacgtgcatgttaaggcaaaggactatatgagtcatctcgtggaacaggcctccctgcac
tttattgtcactgcacgtgtgaacgaaaccactcagatcctgactgcccagtgcgttgtt
ccactgaggagcttcaagctaaacctgaagattgatggaaagccagaattaggaaatcaa
atgagtgtgactgtggaatttcaaaacccactgaaaaaaccactggaaaatgtttccgta
cgccttgaaggtgttgggttgatgagaaccaaaataaaggagtacagtactattcctatg
aacgagtccattaaatggactgaaatgtttgttccggcgaagcctggtctgaggaagatg
attgctagtctggattgcgtggctctcagacaggtttatggagagatacagatcatgatt
aactga

DBGET integrated database retrieval system