KEGG   Latimeria chalumnae (coelacanth): 102363139Help
Entry
102363139         CDS       T02913                                 

Gene name
NEU2
Definition
sialidase 2 (cytosolic sialidase)
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Other glycan degradation
Sphingolipid metabolism
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lcm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lcm00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 391 aa AA seqDB search
MWDRLPREVERLEMHSVLHLQQQPLFRKGEKAYRIPALLYLSQSSEFLAFAEERADLVDE
HAERLVVSRGRFDNDRFFAEWDSPERIASARLPDHRSMNPCPIYDRKTQTIFLFFIAVKG
TTSEAQQINAKRNATRLCYVTSMDMGKTWSSAMDLTEPAVGQTYSKWATFAIGPGHGVQL
QNSTESLVVPAYAYWIHSATERPKPKAFCFISHDHGKTWSIGHCIPNEYAVECQMASIEV
DGKQFLYCNARSLGSRVQAVSHDGGGKFEKGHRASNLVEPPHGCQGSIVGFPEPGPSQAA
KTWMLFSHPTDENKRRDLGIYLNQSPRDHTSWTAPIIIHHGPCAYSDLQYLGLNSEGYPA
FACLFECGKQLEYEEIAFVLFTLKLLFPALC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatcggcttccaagggaagtggagcggctggaaatgcattcagttttgcaccta
caacagcagcccttgtttcgtaaaggggagaaagcctatcgcatccctgctctgctctac
ctgtcccagagctccgagtttctggcatttgctgaggagagagcagacctagtcgacgaa
catgcggaaaggctcgtggttagcagaggcagattcgacaatgatagattttttgcggag
tgggatagtccagaaaggattgcttcggcgaggctgcctgatcacagatcaatgaatcca
tgtccgatctatgatagaaagacccaaaccattttcctcttcttcatcgctgtcaaaggc
accacttcagaagcgcagcaaatcaatgctaaacggaatgccacccggctctgctatgtc
accagcatggatatgggaaagacctggagctccgccatggatctaactgagccagcggtc
ggccaaacctacagcaaatgggcgacgtttgccattggaccgggtcacggagtacagctc
cagaacagtaccgagagccttgtggtcccagcctatgcttattggatccacagtgccact
gaacgccccaagcccaaagccttctgcttcatcagccacgatcacgggaagacgtggtcc
atagggcactgtatcccgaatgagtatgccgtggaatgccagatggcatccatcgaggtg
gatgggaaacaattcctttactgcaatgcccgaagcttggggtcaagggtgcaagcggtc
agccatgatggtggaggaaagtttgagaaagggcatcgagcgtcaaatctagttgagcct
ccccacggttgccagggcagcatcgttgggtttccggagccagggccatctcaagctgcc
aagacctggatgctcttctctcatcccaccgatgagaataagcgaagggatttggggatt
tacctgaaccaatcccctcgggatcatactagctggacagcgcccatcatcatccatcac
ggcccctgtgcttactcggatctgcagtacctcggcctgaactctgaagggtacccagcg
ttcgcctgcttatttgagtgcgggaagcaattggagtatgaagagatagcctttgtcttg
tttaccctcaagctcttgtttcctgctttgtgttag

DBGET integrated database retrieval system