KEGG   Latimeria chalumnae (coelacanth): 102363406Help
Entry
102363406         CDS       T02913                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102363406 (UCHL3)
Peptidases [BR:lcm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102363406 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 230 aa AA seqDB search
MECQRWLPLEANPDVMNQFLSQLGILDSWQFVDVYGMDPELLSMVPRPVCAVLLLFPVTE
KYEAFKLEEEAKIKSQGQEVSSTVYFMKQTISNACGTIGLIHAVTNNRNKLQFEPDSAMK
KFLDESSSLSPEERAKYLEKDESIRVTHESSAQEGQTETPSIDEKVDLHFITFVNVSGHL
YELDGRKPFPINHGCTSNETLLEDAIEICKKFMQRDPEELRFTVVALSQT
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtcagcgttggttgcccttggaagcaaatcctgatgttatgaatcagtttctt
tctcagttgggtatattggatagttggcagtttgtagatgtctatggaatggatcctgag
ctccttagtatggtgccaagaccagtatgcgcagtacttctacttttcccagttacagaa
aagtatgaagcatttaagctggaagaggaggcaaaaatcaagtcacaggggcaagaagtc
agttcaactgtttatttcatgaagcagacaataagcaatgcatgtggaacaataggcctt
attcacgcagtgacaaacaacagaaataaattgcaatttgagcctgattcagcaatgaaa
aagttcttggatgaatcgtcttcactgagtcctgaagaaagggccaaatacctggaaaaa
gatgagagtattcgtgtaactcatgaatcaagcgctcaggaaggacagactgagactcca
agtatagatgaaaaagtagacttgcacttcattacctttgttaatgtaagtggacatctc
tatgaattagatggcagaaaaccttttccaataaatcatggatgcacaagtaatgaaact
ttgctagaggatgcaatagaaatatgtaagaagtttatgcaacgtgatcctgaagaactg
cggtttactgtagtggctctttcccagacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system