KEGG   Latimeria chalumnae (coelacanth): 102363644Help
Entry
102363644         CDS       T02913                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:lcm00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:lcm00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 262 aa AA seqDB search
MSLWLYLPCAAAAVYFTVTFLIPFLARRNATLTILWHDWIDEKLRNWLTGSSRPERILKY
MQKAAVRGNAESVVNAIDEFCNKQEWAMNVGDEKGLILDRVVSEAGPHTVLELGTYCGYS
TVRIARLLKPGARVYSVEFNPSYAKVANQIIDFAGVGDRVEVLEGSSADLIPELKKKFDI
DTFDLVFIDHWKEYYLPDTKLLEAFGLLRKGTVLLADNVVFPGAPEYLAYIRNSPRYRSE
YYQSYLEYTRVEDGLEKSVFLG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctggctatacctgccatgtgctgccgctgcagtatattttactgtaacgttc
ctgatcccgtttctggcacggcgtaacgccaccctcaccatactctggcatgactggatc
gacgagaagctgcgcaactggctgacgggctcctcccgccccgagcggatactgaagtac
atgcagaaggcagctgtccgcggcaacgctgagagtgtggtgaacgccatcgacgagttc
tgtaacaagcaggagtgggccatgaacgtgggagacgagaaaggtctgatcctggatcgg
gtggtctcagaggcgggaccccacaccgtgctagaattggggacgtactgcggatattct
actgtccggattgccaggttactgaagccgggagcccgcgtgtacagtgtggagttcaac
cccagctatgcaaaagtggcaaaccagataatcgacttcgctggcgtaggggacagggtc
gaggttctggaaggttcctctgcggacctgatccctgagctgaagaagaagtttgatatt
gacacctttgatctggttttcatcgaccactggaaggagtactacctaccagacacaaag
ctcttagaggcgtttggactgctgcggaaggggacggtgctcttggccgataacgtggtg
ttcccaggggccccggaatatctggcgtacattcggaacagcccccggtaccggagcgag
tattaccagtcgtacctggagtacacccgggtggaggatggcctggagaaatcagtcttc
ttgggctga

DBGET integrated database retrieval system