KEGG   Latimeria chalumnae (coelacanth): 102363676Help
Entry
102363676         CDS       T02913                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102363676 (CLOCK)
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102363676 (CLOCK)
Transcription factors [BR:lcm03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102363676 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 848 aa AA seqDB search
MLFTMTISKIXSLLFCYRDDNSIFDGLMEDDDKDKAKRVSRNKSEKKRRDQFNVLIKELG
SMLPGNTRKMDKSTILQKTIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEAL
DGFFIAIMTDGSIIYVSESVTPLLEHLPTDLVDQSLLNFLPEREHSEVYKILSTPLLESG
SLTPEHLKSKNQLEFCCHVLRGTIDPKEPPVYEYVKFIGNFKSMNNVPSSTRNGYEGVIQ
RSLRPAYEDRVCFVATVRLVTPQFLKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIG
YLPFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYIT
YHQWNSRPEFIVCTHTVVSYAEVRAERRRELGVESPPEKAADKSQDSGSDTQLNTVSLKE
ALERFDHSRTPSASSRSSRKSSSHTARSDPASTPTKLQTETSTPPRSSLSGIDIASQRRA
SISNQTLSSQTAGQSLSQPVHAQGTATLQIQQNVSQPMLQFSAQLGAMQHLKEQLEQRTR
MIEANIHRQQEELRKIQEQLHLVQGQGLQMFLQQPATGLNFGSVQLSSGNSSNIQQITPI
TMQGQLLPANPIQTGMNTGHIGTPHVLQQQPLQSITTQQNQQTLRTGHSQQSNLPSQNQN
TLSAPLYNTMMISQPAAANVVQIPTSIPQNNHQSGALTTFTQDRQIRFPQGQQLVTKLVT
GPMACGAVMVPTTMFMGQMVTAYPTFATQPQQQPQTLSITQQEQQQQQLGTIQAAGQPQA
QLAQQPQQFFQAPRLLHGSQSTQLILSAAFPLQQQGNYTQSHHQQQQPQQLSRHRTDSMS
DLSNVQPQ
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgctttttactatgaccataagtaaaatctaatcattgcttttctgttatagggatgac
aatagtatttttgatgggctgatggaagatgatgacaaggacaaagcaaaaagggtatca
agaaacaaatctgagaagaagcgcagagatcagtttaatgtccttatcaaagagttggga
tccatgcttccgggcaacacccggaagatggacaaatctactatattgcaaaaaaccatt
gattttttacgaaagcacaaagaaatcacagcgcagtcagatgcaagtgaaatacgacag
gactggaagcctacattccttagtaatgaagagtttacacaattgatgttagaggcccta
gatggattttttatagcaataatgacagatggaagcataatatatgtatctgaaagcgta
actcctctacttgaacatttaccaactgatcttgtggatcagagtctactaaattttctc
ccagagagggagcactcagaggtttataaaattctctccactcctttgttggaaagtggt
tcattgaccccagagcatttaaaatcaaaaaatcaactggagttttgttgccatgtgctt
agaggaacgatagatcctaaggagcctcctgtatatgaatatgtgaaatttataggaaac
ttcaagtccatgaataatgtgccaagttctacacgcaatggctatgaaggtgttatacaa
agatccctgaggcctgcatatgaagacagagtttgctttgtagctacagtaagattagtg
accccacagtttttaaaggaaatgtgtactgtggaagaaccaaatgaagagttcacatcc
aggcatagcttagaatggaaatttttgttcttggaccatagggcacctccaattataggc
tatttaccatttgaagttcttggaacatcaggctatgattactaccatgtggatgaccta
gataatttggcaaaatgccacgagcacttaatgcagtatggaaagggcaaatcctgttac
tacaggttcctgacaaagggacagcagtggatttggcttcagactcactactacatcacc
taccatcagtggaattctaggcctgaatttattgtttgcacacacactgtagtaagttat
gcagaagtgcgagcggaaagaagacgagaacttggtgtcgagtctccgcctgagaaagca
gctgacaagagccaagattctggatctgatactcaactaaacactgtcagtctcaaggaa
gcactagaaaggtttgatcacagtagaacaccatctgcctcctcaaggagttcaagaaag
tcctcatctcacactgcaaggtctgaccctgcttcaacaccaacaaagctacagacagaa
accagtacacctcccaggtcgtctttatctggcattgacatagcttcacaaagaagggcc
tcgataagcaatcagactttaagttcacaaactgctggacagtcgttgtcgcagccagta
catgcacagggcacagcgaccttgcagattcagcaaaacgtgtcacagcctatgttgcag
ttttctgctcagctgggagccatgcagcacttaaaggagcagctggagcaaagaactcgg
atgatagaagcaaatatccataggcagcaagaagagctacgtaagatacaggagcagctt
cacttggtccaagggcaaggccttcagatgtttctgcaacagccagcaactgggttaaac
tttggttctgtacaactttcttctggaaactcttcaaacattcagcaaattacacccata
accatgcagggacagcttcttccagctaaccccattcaaacaggaatgaatacaggacac
attggtactccacatgtactgcagcagcaacctctgcaaagcatcacaacgcagcaaaat
cagcaaacgctacgaacaggacacagtcagcagtctaatctccccagccaaaaccagaac
acactttcagccccactatacaacactatgatgatttcccaaccagcagcagccaatgtg
gtacagatcccaaccagcataccacaaaacaaccaccagagtggtgcacttaccactttt
actcaggacagacaaataagatttcctcaaggccaacagcttgtgacaaagttagtgact
ggtcctatggcctgtggtgcagtaatggtacctacaactatgtttatgggtcagatggta
acagcgtaccccaccttcgccacacagccgcagcagcaacctcagacgctgtcgatcacg
cagcaagagcagcagcagcagcagcttggcactattcaggcagcggggcagccccaagca
cagctggcccagcagccgcaacagttttttcaggcgcccaggttgctccacggtagtcaa
tcaactcagcttattctctcagctgctttcccattacagcaacagggcaactacacacag
tcgcatcaccagcagcagcaaccccagcagctttctcgacacagaactgatagcatgtct
gatctctccaatgtccagccccaataa

DBGET integrated database retrieval system