KEGG   Latimeria chalumnae (coelacanth): 102363820Help
Entry
102363820         CDS       T02913                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102363820 (CREBBP)
   04330 Notch signaling pathway
    102363820 (CREBBP)
   04350 TGF-beta signaling pathway
    102363820 (CREBBP)
   04630 Jak-STAT signaling pathway
    102363820 (CREBBP)
   04068 FoxO signaling pathway
    102363820 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102363820 (CREBBP)
  Cell communication
   04520 Adherens junction
    102363820 (CREBBP)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102363820 (CREBBP)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102363820 (CREBBP)
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102363820 (CREBBP)
Transcription factors [BR:lcm03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102363820 (CREBBP)
Mitochondrial biogenesis [BR:lcm03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102363820 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2415 aa AA seqDB search
MAENLLDGPPNKRPKLNSPALSASDGPDFGLLQDLENDLPDELIPNGGDMNMLGSGGNMV
PDTIANHKQLTELLRGTSGSNVNSGIGMVPSNSPAQPGMGGQAPGQQNSSSVGNLSTMGK
SPRNQGLLSPAASLDKQPASTWGSTTPVSQAQKQGGMVTNSPATSQTGPGGCMGANFNQT
HPALLNNSSGHSLMNQPQQAQGQVMNGSLGGAGRGRGAGLQYSNPGMQGNTGSVLAETLT
QGPAQMGGHAGLNPPQTGTMTKMGMTGNAVPFGQPYPQAGGQQLGATGVNPQLQNKQGMA
NSLPPFPTDIKGTSVANVPNMSPMQPQVQQVGMVQTQGMPTGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRHCSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQPLLGVPSSGIQNPIGTVGTGQQSTPSLSSTNSIDPSSM
QRAYAALGLPYGNQSQAQLQPQVQGQQPPQPQTHQQMRTMNALGTNQMNLAGSGMGVSAT
DQQTNLLPDPSIPSSLGTPNQLMNDGTNAGSVSNLSTMPTAAPPSSTGVRKAWHEHVTQD
LRNHLVHKLVQAIFPTPDPAALKDRRMENLVQYARKVEGDMYESANSRDEYYHLLAEKIY
KIQKELEEKRRSRLQKQGIMGTQTPMQTPGTQSPGIPQGATMGQTQRPVRPPNGPMSISN
VQNQIMNRMQVSQGMNQFNPISMGNVSMQQAPMGPRAASPLSHPVQMSSVPTERKMGMSP
SRMPQPQSMMAAHTNSMVGQTPTQNQFLPQNQFPATTGAMNVNSVGMGQPAVQAGVPQAQ
IPNTTLPMNSMNLMGPQSGQLPCPPVSQPPLHQTLPPASGMPPIQHQTPPGMTPPQAAAT
TRPSTPVSSSGQTPTQTPGALPNVSQTQSTPPLQAPAPSQVVAQPQTPVQPQSVPTPQPP
QQQQPTSVQAQPPGTPLSQSAASMDNRVPTPASVPVVDTNSQQPGPDAPVAETKSEIKLD
ETEPEPSETQVETKTEQPEEESSSSQVKEEAEGSELKQEAMEVEEEKPEVKVEPKEEDEA
GANGTASHSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDY
FDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCTKLAEVF
EQEIDPVMQSLGYCCGRKFEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFNEIQ
GDSVTLGDDPAQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDMIWPLG
FVCENCLKKTVKTRKENKFSAKRLQTTRLGNHLEERVNKFLRRQNHPEAGEVFVRVVASS
DKTVEVKPGMKNRFVDTGEMADSFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPN
TRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKRLGYVTGHIWACPPSEGDDYIFH
CHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFW
PNVLEESIKELEQEEEERKKEENTAANESIDGSQGDSKNAKKKNNKKTNKNKSSISRANK
KKPGMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIIDPDPMLTCDLMDGRD
AFLTLARDKHWEFSSLRRSKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCED
YDLCVNCYNTKSHEHKMVKWGLGLDDEGNGQGEQQSKSPQESRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLN
IKHKLRQQQLQHRLQQAQLIRRRMATMQVRNVPQQSLPSPTSAAPGTPTGQQPSTPQTPQ
PQPSPVNIPAGFSAVPRTQPPTPVSQGKPVNQVAPPPTQPPAAAVEAARQIEREAQKQQQ
LFRVNNMNNGLPINRPGMVTQQVGPVNQMPAMSMNVSRPMSGPVMPTMQPGQWQPAPLSQ
PQSGMARPSIPMTAQQPASVLRMPGVQQPQRSISPNALQDLLRTLKSPSSPQQQQQVLNI
LKSNPQLMAAFIKQRTAKYQASQPGMQSQPQAAMQQPGMHTQPGIQSMSPMQTGVQRPTV
PPQQQGMTGITTPGQTMNLMNPGLNPQYREMFRRHQQGASMGGGHSQFQPPQGPGAYPQA
MQQQRMQHMPMQSGPIGQMPQMAQMNQMAQPVMGADGASSIQTLQQRLLQQQQIKQQMGS
SGQPNPMSPQQHILSGQPQASHLAGQQMATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRI
QPQPSPHHVSPQTGSPHPGLAAPMASSMDQGHLGTPEQSAMLPQLNTPNRGALSSDLALV
GDTTGDTLEKFVEGL
NT seq 7248 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacctgctggacggaccgcccaataagcgacccaaattaaactcgcctgct
ctgtcagcgagtgacggcccagattttggattactgcaggatttggagaatgacctccca
gatgagctgatcccgaatggaggtgacatgaacatgcttggcagtggtggtaacatggtt
ccagatacaatagccaaccacaaacagcttacagaactcttgagaggaactagcggttct
aatgtaaattctgggattggaatggtcccctcaaacagtcctgcccagccaggaatggga
ggtcaggctccaggccaacagaacagctctagtgtgggcaacttgagcactatgggcaaa
agccctcgcaaccaaggacttctgtcaccagctgcaagcttggacaagcagccagccagt
acgtggggatctacaacccctgtgtctcaagcacaaaaacaaggaggcatggtgacaaac
agccctgcaacatcacagactggacctgggggctgcatgggcgctaattttaatcagaca
catccggctcttctcaataacagctctgggcatagtctgatgaatcagccccagcaggca
caggggcaagtaatgaatggatctctcggaggagctggaaggggaaggggagcaggattg
cagtattcaaatccaggcatgcaggggaatacagggagtgtgctggcagaaactctaact
caagggcctgcacaaatgggtggccatgcagggttgaatccaccacagacgggaactatg
acaaaaatgggaatgacgggtaatgcagttccttttgggcagccctaccctcaggctgga
gggcagcaactaggagccacaggagtcaatcctcagttacagaacaaacaaggcatggcc
aacagcttgccaccatttcctactgacatcaagggtacttctgttgccaatgtgccaaat
atgtctccaatgcagccgcaggtacagcaggtaggaatggtacagacccaagggatgcca
actggcccaactgcagatcctgagaaacgcaagttgatacagcagcagctggttctactg
cttcatgctcacaagtgtcagaggcgagagcaagccaatggagaagtgcgacattgttcg
ttgcctcactgtcgaaccatgaagaatgtccttaaccacatgacacattgtcaggctggc
aaggcctgtcaagttgcccactgtgcatcttcacgacaaatcatatctcactggaaaaac
tgcacgaggcatgactgtcctgtctgtctgcccttgaaaaacgccagcgacaaacgaaac
cagcaacctttgttgggtgttccctctagtggaattcagaaccccataggcacagttggg
actggtcaacagagtacaccctctttgagcagcactaattcaatcgaccccagctccatg
cagcgagcttatgctgcactcggactgccctacggtaaccagtcacaagcgcagctgcag
cctcaggtacagggccagcaacctccacagccccagactcaccagcagatgaggacaatg
aatgcactgggtactaatcagatgaaccttgctggaagtggaatgggagtgtcagccact
gatcaacagacaaacctgctgcctgacccatcaataccatcatctcttgggacaccaaat
cagttgatgaatgatggcacaaatgctggcagcgtgagtaatcttagcactatgccaaca
gcagcaccaccttccagcacaggagtaaggaaagcctggcatgaacacgtcactcaggac
ttgcgcaatcacttagtgcataaacttgtccaagccatatttcctactcctgacccagca
gcactgaaggatcgccgcatggagaacctggtacagtatgcgaggaaggtggaaggggac
atgtatgaatccgctaatagcagggatgagtactatcacttgttagcagagaaaatctac
aagatacagaaagagctggaagagaagcgccggtctcgtctacagaaacaggggattatg
ggtactcagacgccgatgcaaactcctggtacccagtccccgggaattccccagggtgca
acaatgggacagacacagcgccctgtcaggccacccaatggacccatgtcgatatctaat
gtacagaatcagataatgaatcgcatgcaggtgtctcaaggaatgaatcagtttaacccc
atatctatggggaatgtgtcaatgcaacaggcacctatgggacctcgtgctgcttctcca
ttgagtcatccagttcaaatgagctcggttccaacggaaagaaagatgggaatgtcacct
tcccgaatgcctcaaccacaaagcatgatggcagctcatactaacagtatggtgggtcaa
acccctacccagaaccagttccttcctcagaatcagtttccagcaaccactggggccatg
aatgtgaacagtgtaggaatggggcaacctgctgtccaagcaggagtgccacaggctcag
attccaaacactactcttcctatgaactccatgaaccttatgggaccgcagagtggtcag
ttgccctgccctcctgtgtcacagccgcctcttcatcaaacattgcctcctgcatcagga
atgcccccaattcaacaccagactccaccaggaatgacaccacctcaggcagcagcaacc
acccgtccttcaacacctgtttcatcttcaggacagactccgacccagacccctggagca
ctacctaatgtgtctcagacacagagcacacctccactacaggctccagctccatctcaa
gttgtagctcagccacagactcctgtacagccccagtctgtaccaacaccacaacctcca
cagcagcagcaaccaacatcagtgcaagctcagcctccaggcactcctctatcgcaatct
gcagctagcatggataacagagtaccaacaccagcctctgtccctgttgtggacacaaac
tcacagcaaccaggccctgatgcaccagtagctgaaacgaaatctgagatcaaactggac
gagacggagccagagccaagtgagacacaggtggaaacaaagacagaacagccggaagaa
gaatcctcctcctcccaggtgaaagaggaggctgaagggtctgagctgaagcaagaggca
atggaggtggaggaagagaaacctgaagtgaaagtggaacctaaagaagaggatgaggct
ggagccaatggcacagcctcccattctacatccccatctcagccacgtaaaaagatcttt
aaacctgaggagttgcgacaggctcttatgcccacacttgaagcattgtatcgacaggac
ccggagtcgctcccctttaggcaacctgtggacccccagcttcttggaatacctgactac
tttgacattgtgaagaatccaatggacttgtcaacaataaaacggaagctggatacagga
cagtaccaagaaccgtggcagtatgtagatgatgtgtggctaatgttcaataatgcctgg
ctttacaaccgcaagacttcacgagtgtataagtactgtaccaaactagctgaagtcttt
gaacaagaaattgatccggttatgcagtcccttggatattgctgtggtcgaaagtttgaa
ttttcaccacagacgttgtgctgctatggtaagcagctgtgtacaattcctcgtgatgct
gcttattacagctaccagaacaggtatcacttctgtgagaagtgtttcaatgagatccag
ggggacagcgtaaccctgggtgatgatccagcgcagccacaaacgaccatttcgaaagac
cagtttgaaaagaagaaaaatgacacactagatcctgagccatttgttgattgtaaagaa
tgtggtcgcaaaatgcatcagatttgtgtactgcattatgatatgatttggcctttaggc
tttgtctgtgagaattgcttaaagaagactgttaaaacaaggaaagagaataaattcagt
gctaaaaggttgcaaacaaccaggctaggaaaccatttagaagagagagtgaacaaattc
ttaagacgacagaaccaccctgaggctggagaggtcttcgtccgggtggtagccagttca
gacaaaactgtggaagttaagccaggaatgaaaaacaggtttgtagatactggtgaaatg
gcagactcttttccttaccgaaccaaagcgctttttgcttttgaagagattgatggagtg
gatgtttgcttttttggaatgcatgtacaggagtatggctcggactgtccaccaccaaat
accaggcgtgtgtacatatcctaccttgacagtattcacttctttcggccacggtgcctc
agaacagcagtttatcatgaaatcctcataggatatttagaatatgtgaagagactcgga
tatgtaaccggtcatatttgggcctgtcctccaagtgaaggtgatgactacattttccat
tgtcatcctcctgatcagaaaatccccaaacccaaaagattacaggaatggtacaaaaaa
atgctggacaaggcatttgctgagagaatcattcatgattataaggatatctttaaacaa
gctactgaagatagactgacaagtgccaaggagttgccatactttgaaggagatttctgg
cccaatgttctggaggaaagcattaaagagctagaacaggaggaggaggaaaggaagaaa
gaggagaacacggcagcaaatgaaagcattgacggtagtcaaggtgacagcaaaaatgcc
aagaaaaagaacaacaagaaaaccaacaagaataaaagcagcataagccgagccaataag
aagaaacctgggatgccaaatgtatccaacgatctgtcccagaaactatatgctactatg
gagaagcacaaagaggtattttttgtaatccatctccatgctggtcctgtgataaatacc
ttgcctcccattattgaccctgaccccatgctgacctgtgacctgatggatggtcgggat
gcattccttaccctagccagagacaagcactgggagttctcctctctgcgccgttccaag
tggtccacgatgtgtatgctggtagagttgcacaatcaaggccaggatcgctttgtctat
acttgcaatgagtgtaaacatcatgtggaaacaaggtggcactgtactgtgtgtgaggat
tatgacctctgcgttaactgctacaacactaaaagtcatgaacataaaatggttaaatgg
ggcctgggcctggacgatgaaggcaatggacaaggagagcagcaatcaaagagcccacag
gagtcacgccggctgagcatccagcgttgtatccaatctcttgtccatgcctgccagtgt
cgcaatgccaactgctcattgccgtcctgccagaagatgaaacgggttgtccagcacact
aagggctgcaaacgcaagaccaatggaggctgtcctgtgtgcaaacaactcatagctctc
tgctgctaccatgccaaacactgccaagagaacaaatgccctgtgccattctgtctcaac
attaaacacaagctaaggcagcagcagcttcagcaccgtctccagcaagcacagttgatt
cgcagaaggatggctaccatgcaggtccgaaatgtgcctcagcaaagtttgccttctcct
acctcagctgcgcctggtactcctacaggtcagcagccgagtacaccacagacaccacag
ccccagccctcccctgtgaacatacctgctgggttttctgctgttcctagaactcagccc
cctacccctgtgtcacaagggaaacctgtaaaccaggtggcaccaccacccacccaacca
cctgctgcagctgtagaagctgctcggcagatcgaacgagaagcccagaagcagcagcag
ctctttagagtcaacaacatgaacaatggtctaccaataaatcgtccaggcatggtgacc
cagcaggtgggtcctgtgaaccagatgccagccatgagtatgaatgtttccaggcctatg
agtggaccagtcatgcccaccatgcagccaggacagtggcaaccagcacccttgtcacag
ccacagtcaggaatggcaagacccagcataccgatgacagcacagcaacctgcttcagtg
ttgagaatgccgggtgtccagcagccgcagcgcagcatctcaccaaatgcacttcaggac
ctgttacggactttaaaatctcccagctctcctcaacaacagcagcaagttcttaatatc
ctcaaatctaacccacagctaatggctgcttttataaaacaaagaacagcaaaataccag
gccagccaacctggtatgcagtctcagccacaggcagctatgcagcaaccaggaatgcat
actcaacctggcatacagagcatgagtcccatgcagacaggagtgcaaaggcccactgta
cccccacagcagcaggggatgactggaattactaccccagggcaaactatgaatttgatg
aatcctgggctgaatccacagtacagagagatgttcaggaggcatcagcaaggagctagt
atgggtggaggacactcccagtttcagccacctcaaggccctggggcttacccccaagcc
atgcaacagcaacgcatgcagcatatgcccatgcaaagtgggcccatagggcaaatgcct
cagatggcacagatgaatcaaatggcccagccagtgatgggggcagatggggcatctagc
attcaaacactgcagcaacggcttttacagcagcagcaaataaaacaacaaatggggtcc
tcaggccagccgaaccccatgagcccccagcagcatatcctctcaggacagccgcaggca
tctcatctcgcgggtcagcagatggccacctctctaagtaaccaggtgcgatcaccagct
ccggttcagtctccgcgtccccagtctcagcctccacattccagcccctcaccgaggata
cagccccagccttctccacatcacgtttcaccacagaccggctccccacacccaggactt
gcagctcccatggctagctccatggatcagggacacttgggcaccccagagcagagtgca
atgcttccacaactaaacacccccaacaggggtgctttatccagcgacttggctctggtt
ggtgacaccacaggcgacacactagaaaaatttgtggaaggtttgtag

DBGET integrated database retrieval system