KEGG   Latimeria chalumnae (coelacanth): 102364120Help
Entry
102364120         CDS       T02913                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102364120 (ABHD6)
Peptidases [BR:lcm01002]
 Serine Peptidases
  Family S33
   102364120 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Lipase Thioesterase Ndr Abhydrolase_3 UPF0227
Motif
Other DBs
NCBI-GeneID: 102364120
NCBI-ProteinID: XP_014344972
Ensembl: ENSLACG00000013052
UniProt: H3AYV4
Position
Un
AA seq 294 aa AA seqDB search
MDLDIMNMFVIAGGTLAIPILAFFASLYLWPAALIRVYYWYWRRALGLQVRYASQGNYRF
CYSCRGKPGNKPSILMLHGFSAHKDMWLSIAKFLPKNLHLICIDMPGHEGTTRTCADDYS
IDGQVKRIHQFVESVKLNRKPFHLVGTSMGGHVAGVYAARFSSDVHSLTLICPAGLEYPN
ESKFVKQLRELEKTQDVYSIPLIPSTPEEMEDMLKLCSYVRFKIPQQILQGLVDVRIPHN
DFYRELFLEIVGEKSRHTLQENMHKISVPTQVIWGKQDQVNLPSFFIVFMKFHP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaccttgatataatgaatatgtttgttattgcgggaggtactctagccatcccaatc
ctggcattttttgcatctttgtacttgtggcctgctgcactcatcagagtttactactgg
tattggcgaagagcactaggcttgcaagttaggtatgcttctcaaggcaattacaggttc
tgctactcctgccgaggaaagcctggaaacaagccatcgatactgatgctgcatggattt
tctgcacacaaggacatgtggctgtctatagccaagttccttcctaaaaacctacacctg
atttgtattgatatgccaggccatgaaggcacgacacgcacatgtgcagatgactactca
atagatggacaggttaaaaggatacatcagtttgttgaatctgtcaagctgaatagaaag
ccctttcacctggtgggtacatccatgggaggacatgttgcaggagtctatgctgctcgg
ttctcatctgatgttcacagtttgaccttaatttgtcctgctggtttggaatacccaaat
gaaagtaaatttgtgaaacagttgagagagttggaaaagactcaagatgtctatagtatt
cctttaatcccatcaacgccagaagaaatggaagacatgctgaagctttgctcatatgtt
cgctttaagataccacaacagattcttcagggacttgttgatgttcgaattccacacaat
gatttttatcgtgaattgtttttagaaatagtaggtgagaagtcaagacacaccttacaa
gaaaatatgcacaagatctcagtcccaacacaagttatttggggaaagcaagatcaggta
aatttacctagtttctttattgtctttatgaagtttcacccatag

DBGET integrated database retrieval system