KEGG   Latimeria chalumnae (coelacanth): 102364413Help
Entry
102364413         CDS       T02913                                 

Gene name
BAP1
Definition
(RefSeq) BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102364413 (BAP1)
Peptidases [BR:lcm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102364413 (BAP1)
Ubiquitin system [BR:lcm04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102364413 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 700 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGDHRTLLLRLFDPLPLLFLRGSPVYGFIFLFKWIEERR
SRRKVSTLVDETSVIDDEIVNNMFFAHQSRGKPGSVCRKEFTKGFSPESKGYAIGNAPEL
AKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKAYPIDHGPWG
EDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYESKLHILKMNRQTVLE
GLQQLIRITQPELIQTQKSQESQSPEEPRLPGSKAAPERDGSRMQPTQEAMHTDGTENLA
PQSQSASTPSPLNKAKPSGKSPVCGLNGAPVTPTPVVQRLPAFLDNHNYAKSPMQEEEDL
AAGVGRSRLPQHHHYSDDEEDYDEEEEEDTNSAIRKGQLKQESRTRSSEEKLSVLQPNTI
NVLAEKLKESQKDLSIPLSIKTSGSVVTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIR
SANPTRPSSPVTSHISKVLFGEEDCLLRVDCMRYNRAVKELGSNISTGLLHLAEEGVLHT
LTIAGDPSTDSSKTSPGKKSKETVSDVKMEDEKETPASCDRKEKAGGGEICDQHSGEKYS
PKELLALLKCVEAEIANCEACLKEEVEKRKKYKIDDQRRTHNYDEFICTFISMLAQEGML
ASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKR
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggctggctggagctggagagcgacccagggctcttcaccctgctggtagaa
gattttggtgaccatcggacgctgctgcttcggctgtttgaccctcttcccctcttgttc
ctccgtggcagccccgtgtatggcttcatcttcctgtttaagtggattgaggagcgtcgt
tctcggaggaaggtctccactctggtggatgagacgtccgtaattgatgatgagattgtc
aacaacatgttcttcgctcaccagtccagaggtaagcctggcagcgtgtgtaggaaggag
ttcacaaagggattcagtccagagagtaaaggttatgctatcggcaatgctcctgaactg
gcgaaagcacacaacagccatgcaaggccggagcctcgtcacctcccagagaaacagaat
ggaatcagcgcagtgaggacgatggaggccttccactttgtcagctatgttccaatcaaa
gggagactctttgagctggacgggctcaaagcctatcccattgaccatggtccgtgggga
gaggatgaagaatggacagataaggctcggcgagtcatcatggagagaatcgggctggcc
actgctggtgagccgtaccacgacatccgctttaacctgatggctgtggttccagatcgg
aggattaagtacgaatccaaactgcacatcctgaagatgaaccggcagacggtgctggag
ggtttacagcagttgatacgaataacccagccggagctgatccagacccaaaaatcccag
gaatcccagtctcccgaggagcccagactgccgggcagcaaggcggcccccgagcgggac
ggcagccggatgcagccaacgcaggaggcaatgcacacagatggtaccgagaatttggcg
ccccagagccagtctgcttccactccaagcccactaaacaaagcaaagccttctgggaaa
tctcctgtgtgcggtttgaacggagccccggtgacgcccacccctgttgtgcagagatta
ccggccttcctggacaaccacaactacgccaagtcacccatgcaggaggaggaagattta
gcggctggagtgggacggagtcggttaccacagcaccaccattactcagatgatgaggaa
gactatgacgaggaagaggaggaggataccaacagtgcaatcaggaagggtcaactgaag
caggagtcgaggacaaggagttcagaggagaagctgtctgtccttcaacccaacacaatc
aatgtcttggctgagaagctaaaggagtcccagaaggacctgtccatcccgctatccatc
aagaccagtggcagcgtggtcacccactcccagccgtcgccaacccccagcaatgagagt
acagacaccgcctcggaaattgggagcgccttcaactcaccactgcgctcgccgatccgc
tcggccaaccccacccgaccttccagccctgtcacctcccacatctccaaggtgctgttt
ggggaggaggactgcctgttgcgagtggactgtatgcgctacaaccgggcagtgaaggag
ctggggagtaacatcagtactggtctactccacctcgcagaagagggggtgctccacaca
ctcactattgcaggagacccctctacagattcctccaaaacttctccgggcaagaagagc
aaggaaacggtgtcagatgtcaaaatggaggacgagaaggagactcctgcatcatgtgac
aggaaggagaaagcaggagggggtgaaatttgtgaccagcattctggagagaaatattcc
cccaaggagctgctggccttgctgaagtgcgtggaggcagagatcgcaaactgtgaggcg
tgtctgaaagaagaggtggagaagagaaagaaatacaagatcgatgatcagcgaagaacc
cacaactatgacgagtttatctgtacatttatctccatgctggcacaagaagggatgctg
gccagcctggtggaacagaacatctctgtgcgccgacggcagggtgtcagcattgggcgc
ctccacaaacagaggaagccggaccgcaggaaacgctccaggccgtacaaagctaagcgc
tag

DBGET integrated database retrieval system