KEGG   Latimeria chalumnae (coelacanth): 102364810Help
Entry
102364810         CDS       T02913                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102364810 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 375 aa AA seqDB search
MSVNYAAGLSPYSDKGICGLPEMFDSPEELDRKVLEVAELIRNASYVVFHTGAGISTSTG
IPDFRGPNGVWTMEERGLAPKFDTTFEEARPSKTHMALLELERVGTLKYLISQNVDGIHV
RSGFPRDKLAELHGNMFVEECLKCGKQYVRDHVVGTMGLKQTGRLCDVVKSRGLRACRGK
LRDTILDWEDSLPDRDLNLADEACRKADLAITLGTSLQIKPSGNLPLITKRKGGKLVIVN
LQPTKHDRQADLRISGYVDEVMCKLMKHLGLEIPEWTGPTVVESSAHGEMKSELLTNVQI
KTENEIKPESDLKPPTKAELDSVLNGSSVHLDRRVLGPEQGPDSGEHCKRLKREGCNANC
TTRETKQPKVESLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgccgctggactctcgccttattcggacaaggggatatgcgggctc
cccgagatgttcgactctcctgaagagttggatagaaaggtgctggaagtagcagaactg
ataaggaatgcttcctatgtggtatttcacaccggagcaggaatcagcacctcaactggc
attcctgattttagagggccaaatggagtgtggacaatggaagaaagaggccttgcccct
aagtttgacaccacctttgaagaagccaggccctcaaagactcacatggcgttgttggag
ctggagcgagttggtaccttgaagtacctgatcagtcagaatgtggatggcatacatgtc
agatcaggatttccacgcgataagttggctgagctccatgggaatatgtttgtggaagag
tgtttgaaatgtggcaaacagtacgttcgagaccatgtggttggtacaatggggttaaag
caaactggcaggctgtgtgatgttgtcaaatctagaggtctccgtgcttgtagaggcaaa
ttacgggatacaattttagactgggaggattcgttaccggatcgagatctgaaccttgcc
gatgaagcctgcagaaaagcagatcttgccatcacacttgggacctccctacagattaaa
cccagtggcaatctaccgctgatcactaaaaggaaaggaggaaagctggtgatagtcaac
ttgcagcccaccaaacacgacagacaagctgatctgaggataagtggttacgttgatgag
gtcatgtgcaaactaatgaagcatctcggcttggagataccagagtggaccgggcctacc
gtggtggaatcctccgcccacggcgagatgaaatcggagcttctgaccaatgtgcagatt
aagacggagaacgagattaaaccagagagcgacctcaaacccccaaccaaagcagaactt
gattcagtgctaaatgggagcagcgtgcatctggacagaagagtcctgggaccagaacaa
ggtcctgattcaggagagcattgcaaacggctgaaacgagaaggctgcaatgcaaactgt
accacgagagaaacgaagcagcctaaagttgaatctcttgtagcataa

DBGET integrated database retrieval system