KEGG   Latimeria chalumnae (coelacanth): 102365035Help
Entry
102365035         CDS       T02913                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102365035 (GTF3C4)
Transcription machinery [BR:lcm03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     102365035 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 814 aa AA seqDB search
MAAAGGSGWSEREAGQSRGSGTSTGALLKREPAVKLQHLVSGLEPLAWSEDNRVSVSTSR
SINILEQVCDIHSSGQDMVIQRTSVPAPLNTCLLKIGSKKEVAECKEKFANSKDPAVSQT
FMLDRVFNPEGGSLPPMRGFKYTSWSPLGCDINGRCLLAALTLDNRLTIHASLNRLQWTQ
LVDLTEIYGEMLYESSYKMSGTEVPRGDPEDFAEFQRRHSMQCPLRMEWSSVCTTQQVKH
NNECKDIGTVLLAVLLENGQVAVWQFQLPFLGKESITSCNTIDSGIVSPSVLSWWEYEHN
SRKMSGLIVGSAVGPVKIIPVNLKAIKGYFTLRQAVVLWHETDQLPVHNIKCLPLKHPYQ
KCNCSLVVAVRGSYVFWCLLLISKAGLNVHNSHVTGLHSVPIVSMTANKQSGVIYTCSSD
GSIRKLTPVFTEVAVKFDHQPIKLSDLFGSVKVHGIAISPNAAYLAVVTSEGLNNKLHPV
NKTCHVQFITLKTSEDAASQLIDSPIQNLFRQVDLLDLVRWKVLREKRVPRTLQKSLDKK
IQTTGALYLWRFKLFLLRIWYQSLQKVPSDALWKPTHETKKVLLCDGATPSSNDEESQQG
DEEEDGESSTKTKVVNRQDTEGALSSNVPGGEQAEVASVLSREAAPAASNAGRQEAVEEQ
INEIRGKIEAVEMHLTREHMKQVLGEVYLHTWITENTSIPSRGVCDFLMSDPTYDDRTAR
VLIGHILKKMNKQTFPEHCSLCKEILPFTDYRQAVCPNGHVWLRCILTYQACQIMTYRRC
LLQDSIARHSVPEDPEWIKRLLQGPCAFCDSPLF
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgggaggctcgggctggtcggagcgcgaagcgggacagagtcgcggcagc
ggcaccagcaccggcgctttgctgaaacgggaacccgccgtgaagttgcagcacttggtg
agcggcctggagcccctggcctggtcggaggataaccgggtttcggtctccaccagccgc
agcatcaacattctggagcaggtctgcgacatccacagctccggccaggacatggtgatc
cagcgcacctccgtcccggctccgctcaacacctgcttactgaagattggttccaaaaaa
gaagttgcagaatgcaaggaaaagtttgccaattcaaaagatccagcagtcagccagacg
tttatgttggacagagttttcaaccctgaagggggctccttaccacccatgcgaggtttc
aagtatacaagttggtctccattgggctgtgatatcaatgggcgatgcttattggcagct
ttaaccttggacaataggttaacaattcacgccagtctaaacagactccagtggacgcag
cttgttgacctcactgaaatatatggagaaatgttgtatgagtccagctacaagatgtct
ggaacggaagtgccaagaggggatccggaggactttgccgagttccagaggaggcacagc
atgcagtgtcctcttcggatggagtggtcaagtgtctgtaccacccagcaggtaaaacac
aataatgaatgcaaagacataggcactgtgctgctagccgtcctcctggaaaatggccag
gttgcggtttggcagtttcagcttccctttttggggaaggagtccatcacctcttgcaac
accatcgactctggaattgtgtctcccagcgttctgtcctggtgggaatatgagcacaac
agtaggaaaatgagtggactgattgttgggagtgctgttggaccagttaaaatcataccc
gtcaacttaaaagctatcaaaggctactttacgctgagacaagcagttgtcttgtggcat
gagacggaccagttgccagtgcacaacattaaatgtttacccctgaaacacccttatcag
aaatgtaactgtagcctagttgtagcagtgagaggatcttatgtgttttggtgcctcctt
ctgatctccaaagctggtctcaatgtacataattcccatgtgacaggacttcattcggta
cctattgtgtctatgactgccaacaagcaaagtggtgtcatctacacatgctccagtgat
ggcagcatcaggaagctcaccccagtcttcactgaagttgcagtgaaatttgaccatcag
ccgattaagctgtctgacttgtttggctcagtgaaagtgcacgggatagccatcagccct
aatgcagcatacctggctgtagttacatccgagggtttgaacaacaagcttcatccggtc
aacaaaacctgtcatgtccagttcataacactgaaaacatctgaagatgcagcctctcag
cttatagactctcctatccagaacttgttcaggcaggtggacctgctggaccttgtcagg
tggaaagtcttgagagaaaagcgagttcctcggactctccagaaaagtttggacaagaag
atccagacaactggggccctttacctctggaggttcaaacttttcttgctaaggatttgg
taccaatccttacaaaaagtaccatctgatgcgctgtggaagccaacacacgaaaccaag
aaggtactgttgtgcgatggtgctacgccttccagcaatgatgaagagtcccaacaaggg
gacgaggaagaagatggggaaagcagcaccaagacaaaggtggtgaacaggcaggacaca
gagggagctctaagcagcaatgtacctgggggagagcaagccgaggtcgcctctgtctta
tcgagggaagcagcacctgcagctagtaatgcaggtcgtcaggaagccgtggaggagcag
atcaacgagatccggggaaagattgaagctgtagagatgcatctgaccagggaacacatg
aaacaggtccttggggaagtctaccttcacacatggattacagagaacactagtatcccc
tccaggggggtttgcgacttcctcatgtctgaccctacttatgatgataggacagcacgg
gtgctgattggacacatactgaaaaagatgaacaaacagacgttcccagagcactgtagc
ttgtgtaaagagatcctgcccttcacggattacaggcaggcagtctgccccaacggacat
gtctggctcaggtgtatactaacttaccaggcctgccagatcatgacgtacagaaggtgc
ttattacaagacagcattgcacgacattcagtacctgaagatcctgagtggataaagcgg
ttgctacaaggaccctgtgctttctgtgattctcctctcttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system