KEGG   Latimeria chalumnae (coelacanth): 102365271Help
Entry
102365271         CDS       T02913                                 

Gene name
AMY1A
Definition
amylase, alpha 1A (salivary)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102365271 (AMY1A)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102365271 (AMY1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 516 aa AA seqDB search
MSEDMRILTLLAVLGVCWAQYNPNTQPHKTAIVHLFEWRWVDIAAECERYLAPNGFGGVQ
ISPPNDHIVLNNPWMPWYERYQPISYKLCSRSGTENEFVDMVTRCNNVGVYIYADAVINH
MCGASGGAGTHSSCGTYFNAGTEDFPAVPYSSWEFNDGKCKTKSGEIESYQDANQVRDCR
LVSLLDLNLQKDYVRGKIAEYMNRLIRIGVAGFRVDGSKHMWPGDMKAVFDQLNSLNTRW
FPKDSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGYVIRKWNGEKMAYLKNWG
EGWSFMPSDKAVVFVDNHDTQRGHGPGGASVLTFWNSRMYKIAVGFMLAHPYGFTRVMSS
FRWPRHFVNGKDTNDWIGPPSYSDGTTKRVTINPDTTCGNDWVCEHRWRQIKNMVMFRNV
VDGQPFSNWWDNGSNQIAFGRGNKGFIIFNNDDWYMDVTLQTGLPAGTYCDVISGQMENG
ACTAVQIQVNDDGRANFKISNTAEDPFIAIHVNAKL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagatatgaggatcctcactctacttgctgtgcttggagtgtgctgggctcag
tataaccccaatactcagcctcacaaaacagctattgttcatttgtttgaatggcgctgg
gttgacattgctgcagaatgtgaacgttacttagcacctaatggatttggcggtgttcag
atttctcctcctaatgaccatattgtgctcaataacccctggatgccatggtatgaaagg
tatcaacctatcagttacaagctgtgctcaagatcaggcactgaaaatgagtttgtggac
atggtgaccagatgtaataatgttggagtatatatctatgcagatgcagtgatcaatcac
atgtgtggagcatcaggtggagctggtacacattcatcttgtggaacctactttaatgct
ggaactgaagactttcctgctgtcccatattcttcctgggagttcaatgatggtaaatgt
aaaacaaaaagtggtgaaattgaaagctaccaagatgctaatcaggttcgtgattgccgt
cttgttagtctacttgaccttaacctgcagaaggactacgtgcgaggaaagattgctgag
tacatgaacaggctaattagaattggtgtggcaggatttagagttgatggttccaaacac
atgtggcctggtgatatgaaagcagtctttgatcaactgaatagtctgaatactcgctgg
ttccccaaagattctaaacctttcatctaccaagaggtcattgacttaggtggagagcct
attaaatccagtgactattttggaaatggacgtgtaactgagtttaaatatggtgccaaa
ctgggttatgttatccgcaaatggaatggagaaaagatggcttacttaaagaattggggt
gaaggctggagttttatgccctcagacaaagctgttgtctttgtggataaccatgacact
cagcgaggacatggccctggaggggcttctgttctcacattctggaattctagaatgtac
aaaatagcagttggattcatgcttgcacatccttatggattcacacgtgtaatgtccagc
tttcgctggcctagacattttgtaaatggaaaggatacaaatgattggattggacctcca
agttactctgatggaacaactaaacgagtcacgatcaacccggatactacctgtggcaat
gactgggtctgtgaacacagatggcggcaaataaagaatatggttatgtttcgtaatgta
gttgatggtcagcctttttccaactggtgggacaatggaagcaatcagatagcttttggt
cgtggtaacaaaggatttatcatctttaacaatgatgactggtacatggatgtgacttta
cagactggcctccctgcaggaacttactgtgatgttatctctggacaaatggagaatgga
gcctgcactgctgttcagattcaagtaaatgatgatggaagagccaactttaagattagc
aatactgctgaagatccatttattgcaattcatgtaaatgccaaattgtaa

DBGET integrated database retrieval system