KEGG   Latimeria chalumnae (coelacanth): 102366092Help
Entry
102366092         CDS       T02913                                 

Gene name
KAT2B
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102366092 (KAT2B)
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102366092 (KAT2B)
Transcription machinery [BR:lcm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102366092 (KAT2B)
Chromosome [BR:lcm03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102366092 (KAT2B)
   HAT complexes
    PCAF complex
     102366092 (KAT2B)
    STAGA complex
     102366092 (KAT2B)
    TFTC complex
     102366092 (KAT2B)
    SAGA complex
     102366092 (KAT2B)
    SLIK complex
     102366092 (KAT2B)
    ADA-HAT complex
     102366092 (KAT2B)
    HAT-A2 complex
     102366092 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 793 aa AA seqDB search
MSEGGGVQQGSPAPGSAGSVPAGGADGSGSAAGSARIAMKKAQLRAAPRAKKLEKLGVYS
ACKAEESCKCNGWKSPNPPPTPPRVDLQQTVGSLTEPCRSCSHTLADHVSHLENVLEEEM
NRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPAVEGSLESPPFEKP
SIEQGVNNFVQYKFSHLPPKERQTIVELAKMFLSRINYWQLETPSQRRLHSPNDDLAGYK
VNYTRWLCYCNVPHFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQDKEKLPLEKR
TLILTHFPKFLSMLEEEVYSQSSPIWDQDFMASSSRDGQLGIETVINPSPAARPFSYTAS
PSPLDQPNSGSLSPACKVPSAPESNTVEKRKLNEPFTLGDAKRPRVIGDIPMELINEVMS
TITDPAAMLGPETSFLSAHSARDEAARLEERRGVIEFHVIGNSLNQKLNKKIMIWLVGLQ
NVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRIFPTQGFTEIVFCAVTSN
EQVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKEIKVPKAKYVGYIKD
YEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKMIERKQAQIRKVYPGLSCFKEGVRQIP
IESIPGIRESGWKPSGKERGKEPKDLEQLYCTLKNILQQVKSHQSAWPFMEPVKKTEAPG
YYDVIRFPMDLKTMSERLKNRYYVAKKLFMADMQRVFTNCREYNPPESEYFKCANVLEKF
FYTKIKEAGLIDK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagggcggaggagtgcagcagggctccccggctccggggagcgcgggctctgtc
ccggccggaggtgctgacggctcgggcagcgccgccggatcagcgcggatcgcgatgaaa
aaggcgcaacttcgagcagctccccgggcaaagaagctggagaagcttggcgtctactcg
gcatgcaaggctgaggaatcctgtaagtgtaatggatggaagagtccaaaccctcccccg
actcctccaagggtagacctgcagcaaacagtcggcagtctcaccgagccatgtcgtagc
tgtagtcatacactggctgatcatgtttcccatttggagaatgttttagaggaagaaatg
aatcggctgctgggtatagtgttagatgtggagtatctcttcacctgtgtccataaggaa
gaggatgcggatacgaaacaagtttacttctacttgtttaaacttctgagaaaatgcatc
ttacaaatggggaaaccagctgtggaagggtcactggaaagccccccttttgagaagccc
agcatcgaacagggagtcaataattttgtgcagtacaagttcagccatcttcccccaaaa
gagaggcaaacaatagtggagctagcgaaaatgtttctgagccgtatcaactactggcag
ctggagacaccttcccaaaggagacttcattcacctaatgatgatcttgctggctacaaa
gtgaattacacaaggtggctttgctactgcaatgtcccccatttctgtgacagcctccct
cggtacgagaccacccaagtgtttggcagaacacttctccgctctgtcttcactgtcatg
aggagacagttactggagcaggccaggcaggataaagagaaacttccacttgagaaacga
acgttgatacttacccattttccaaaattcctttctatgttggaggaggaagtttatagt
caaagctcacccatctgggatcaggacttcatggcttcttcctctagagatggtcagtta
gggatagaaacagtgattaacccttctccagcagccagaccattttcttacactgccagt
ccatcacctttagatcagcccaacagtggaagtctgagtcctgcctgcaaggtaccgtca
gccccagaatcaaacacagtagagaaaaggaaacttaatgagccatttactttgggagat
gctaagaggccaagggttataggagacattcctatggagttgattaatgaagtgatgtca
acaattacagacccagctgctatgctaggacctgaaactagctttctgtcggcacattca
gccagagacgaggcagcaaggttggaggagcgaagaggagtgattgagtttcatgtcatt
ggaaactccctaaaccaaaagctaaacaaaaagatcatgatatggctggttggcctgcag
aacgtcttctcccatcagctacccagaatgcctaaagagtatatcacgcggcttgtcttt
gatccgaaacacaagactttggctctaataaaagatggccgtgtgataggtggtatctgc
ttccgaatatttccaacacaaggctttacagagatagttttctgtgctgttacctctaat
gagcaagttaagggttacggaactcaccttatgaatcatctgaaggaataccacattaaa
cataatattctgaattttctcacatatgcagatgaatatgcaattggctacttcaagaag
cagggattctccaaggaaattaaagtaccaaaagccaaatacgttggctatatcaaagat
tatgaaggagccacactaatgggatgtgagttaaatcccaggattccatacactgaattt
tctgtcatcataaagaaacagaaggagataataaagaagatgatagaaaggaagcaagcc
cagattcgaaaagtttaccctgggctttcctgttttaaagagggagtgcggcagattcct
atagaaagcattccaggaataagagaaagtggttggaaacccagtggaaaagaaagagga
aaggagcctaaggaccttgaacaactttactgcaccttaaaaaacatcctgcagcaggtg
aagagccaccagagtgcctggcctttcatggaacctgtcaagaaaacggaggcacccggt
tattatgatgtaatacgcttccccatggatcttaaaacaatgagtgaacgccttaaaaac
cggtactacgtggccaagaagttgttcatggcagacatgcaacgggtctttacaaactgc
cgagaatacaatcctccagaaagtgaatattttaaatgtgctaatgtactggaaaaattc
ttctacaccaaaattaaggaggctggactgattgacaaatga

DBGET integrated database retrieval system