KEGG   Latimeria chalumnae (coelacanth): 102366664Help
Entry
102366664         CDS       T02913                                 

Gene name
KAT8
Definition
(RefSeq) K(lysine) acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102366664 (KAT8)
Chromosome [BR:lcm03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102366664 (KAT8)
   HAT complexes
    NSL complex
     102366664 (KAT8)
    MSL complex
     102366664 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 492 aa AA seqDB search
MASAGAGESVKAERMETAAENGGENPAGRAVEPAESRRESEAGGVVNGEREKEPEPPPQS
RAGESEESGGGGGAQGGDGTAAPPGGGISNNNNSGGGGVGVLNNGTSGCGAGREQEVAVE
IGETYLCRRADNTWHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTLK
EAVQKNTDQYMSELSEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKV
KYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKFEKTYRYHLTQCQWRQPP
GKEIYRKSNISVYEVDGRDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRYGA
HIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSKYTLHVRSGATPPPVGPTSE
AQNHTASCRAYDLMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKP
PITGSYITGCKG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggcaggagcgggcgagtccgttaaagcggagcgaatggagactgcggcggag
aacggcggcgagaaccccgcggggcgcgccgtggagccggcggagagccgccgggagtcg
gaagcggggggcgtggtgaacggagagagggagaaagagccggagccgccgccgcagagc
cgagctggggagtctgaggagagcggcggcggcggcggtgcgcagggcggagatggaaca
gcagcgccacctggtggcgggatcagtaacaacaacaacagcggcggcggcggcgttggc
gttctgaataatggaaccagcggctgcggcgccggcagggagcaggaggtggcggtagag
atcggggagacctacctttgcaggagggcagacaacacctggcattcagcggaggtaatc
caatcccgattaaatgaacaggagggcagagaagaattctatgtgcactatgttggattc
aatcggcggctggacgagtgggtggataagaatcggctggcgctgaccaagacgctgaag
gaggcggtacagaagaacacagaccagtacatgagcgagctgtcggagcagccggagcgc
aagatcacccgcaaccagaaacgcaaacacgatgaaatcaaccacgtccagaagacgtac
gcagagatggaccccacaacagccgcactggagaaagaacacgaggcgatcacaaaggtg
aaatatgtggataagatccacattgggaattatgagatcgacgcctggtacttctcgccc
ttcccagaggattatgggaaacagccaaagctttggatctgtgaatattgcctcaagtac
atgaagtttgagaagacataccgctatcatctgacacagtgtcaatggcggcagcccccg
ggcaaggagatctacagaaagagcaacatctcggtgtatgaagtggacggccgggatcac
aagatctactgccagaatctctgcttgctagccaagctcttcctggaccacaagaccctg
tacttcgacgtggagccgtttgtattttacatcctgactgaggtggatcgctacggagcc
cacattgtgggatacttctccaaggagaaagaatctccagatggtaacaatgtcgcctgt
attctcactctgcccccgtaccagagacgtggctacggcaaattcctaatagcattcagt
aagtacactttacacgtgagatctggagccacaccgcctcctgtagggcctacgagtgag
gcccagaaccacaccgcctcctgtagggcctacgatctgatgacaagtataacacagaat
gatatcatcagcacactgcagtcactgaacatggtgaagtactggaaggggcaacacgtc
atctgtgtgacacccaaactggtcgaggaacatctgaaaagcgcccagtacaagaagcct
cccattacaggttcgtacatcacggggtgtaaggggtga

DBGET integrated database retrieval system