KEGG   Latimeria chalumnae (coelacanth): 102366786Help
Entry
102366786         CDS       T02913                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102366786
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102366786
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102366786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 507 aa AA seqDB search
MELLRTLSLGFYLMCAVAAGIIPAKERDPNYWRQQAQGTLRNALNHQHNTNVAKNVVLFL
GDGMGLATVTAARILKGQMKNKLGEETLLTMETFPHVALSKTYNIDLQVPDSAGAATAFL
CGVKANSGTVGVSAAAFNGICTSQFGNEVTSILKWAKDTGKSVGVVTTTRVQHASPAAAY
AHSVNRRWYTDSNVPAAAKKEGCRDIAYQLVFNTDIDVIMGGGRKYMTAKGTPDPEYPLD
FRSRGTREDGLDLVTEWQRNKTGKVAHYVWNKQDFDAVNANTTDYLLALFEPSDMKYEQD
RNPEKDPSIVEMTEKAIQILQRNPKGFFLFVEGGRIDQGHHAGKASQALHEAVMLDNAIQ
KAIELTSEEDTLTVVTADHSHAFIFGGQPLRGNPILGKSSLFATDFMPYTTLLYGNGPGF
KISNDKRPDIQKVNTASKDYLQQAAVPLDSETHGGEDVAIFARGPMAHLFHGVQEQNYIA
HVMAYAACIGQNLEHCAGQSSPAQVAQ
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagctccttagaacattgtccctgggtttctaccttatgtgtgctgtggctgctggc
attattccagctaaagaaagagatccaaattactggcgtcaacaggcccagggtaccctc
cgcaatgccctcaatcaccaacataacaccaacgtggcaaagaatgttgtactcttcctg
ggagatggaatgggtcttgctacagtgacagcagccaggattctcaaaggtcagatgaag
aacaaattgggtgaagaaacactccttaccatggaaacatttccacatgtcgccctctca
aagacttacaacattgacctgcaagtcccagacagtgctggagcggcgactgcattcctc
tgtggggtgaaggccaattcgggaacagtgggggtgagtgctgcagctttcaatgggatc
tgcacctcccagtttggaaatgaagttacttccatcctaaagtgggccaaggatacaggt
aaatctgttggtgttgttacaacgacaagggttcagcatgccagcccagcagctgcctac
gcccacagtgtaaacaggcggtggtacacggacagcaacgtcccagctgcagccaagaaa
gaaggctgccgagatattgcctatcagctggtcttcaacactgatattgatgtgatcatg
ggaggtggacggaagtatatgacagcaaagggcacacctgatccggagtaccccttagac
ttcaggtcccggggcaccagggaagatggcctggaccttgtcactgaatggcagaggaac
aaaactggcaaggttgcccattatgtgtggaataaacaagactttgatgctgtgaatgca
aataccacagactacctattggcactgtttgaacccagtgacatgaagtatgagcaggac
agaaacccagagaaggacccatccattgtagagatgacagagaaagctatccagatcctc
cagagaaaccccaaaggattcttcctctttgtggaaggtggcagaattgaccagggtcac
catgcaggcaaagcctcacaggcactgcatgaggctgtgatgttggacaatgccattcag
aaggcaatagaactgacttcagaggaagacaccctgactgttgtgacagcggaccactcc
cacgccttcatctttggtggccaaccattgcgggggaacccaattctaggtaaatcctcc
ctctttgccactgattttatgccgtacacaacgctgctgtatgggaatggacccggcttt
aagatatccaatgacaaaaggccagacattcaaaaagttaatactgcttctaaagactat
ttgcagcaggctgcggtgcctttggactcagaaacgcacggaggggaagacgtcgctatt
ttcgcccgaggcccgatggctcacctcttccatggggtccaggagcagaattacattgca
cacgttatggcgtacgcggcttgcattggtcaaaatctggaacactgtgctggccagtca
tctccagcacaggtagcccagtga

DBGET integrated database retrieval system