KEGG   Leuconostoc carnosum: C270_00220Help
Entry
C270_00220        CDS       T02321                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00010  Glycolysis / Gluconeogenesis
lcn00350  Tyrosine metabolism
lcn00620  Pyruvate metabolism
lcn00625  Chloroalkane and chloroalkene degradation
lcn00626  Naphthalene degradation
lcn00650  Butanoate metabolism
lcn01100  Metabolic pathways
lcn01110  Biosynthesis of secondary metabolites
lcn01120  Microbial metabolism in diverse environments
lcn01130  Biosynthesis of antibiotics
lcn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_00220
   00620 Pyruvate metabolism
    C270_00220
   00650 Butanoate metabolism
    C270_00220
  Lipid metabolism
   00071 Fatty acid degradation
    C270_00220
  Amino acid metabolism
   00350 Tyrosine metabolism
    C270_00220
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C270_00220
   00626 Naphthalene degradation
    C270_00220
Enzymes [BR:lcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C270_00220
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     C270_00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 GxGYxYP_N
Motif
Other DBs
NCBI-ProteinID: AFT80963
UniProt: K0D821
Position
55210..57912
Genome map
AA seq 900 aa AA seqDB search
MANATEKKPEKKVLTPEEKANLQAQAEKMTAELVKKSQQALAEFSTFTQEQVDTIVAAMA
LAGSQNSLVLAHEAHDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVINEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKSSAHAAQIVYEAAVK
AGAPKNFIQWIEKPSIYGTSALIQNTGIASILATGGPSMVNAALKSGNPSMGVGAGNGAI
YLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQSPIYDEVLKKLQDQGAYLVPKKDY
KKIADYVFKANAEGYGVAGPVAGMSGRWIAEQAGVKVPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKRQEAIDTVQSLLNYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWVRL
PKEVYYESNAITYLQDLPSINRAFIVADPGMVQFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSQAVDIARQMAAFKPDTVILLGGGSALDAGKIGRFLYEYSTRNEGILEDEEQIKA
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDTTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHALESYVSVMASEFTRPWALQAIKLIFDN
LAESYRYDPKNPTKEGQTARTKMHYASTLAGMSFANAFLGINHSLAHKVGGEFELPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARHIGLKGSTDAELVDALITAI
KKLAKSVEVDQTLTGNGVKKADLERNIDALTDLVYNDQCTPGNPRQPSLDEIKQLLRDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgcaactgaaaagaaacctgaaaaaaaggttttaacaccagaagaaaaggca
aatttacaagcacaagctgaaaaaatgactgccgagttagttaaaaaatcacaacaggcg
ttagcagaattttcaactttcacacaagaacaagttgatacaattgtggcggctatggcg
ttagctggttcgcaaaattcattggtattggctcacgaagcacatgatgaaactggtcgt
ggtgtggttgaagataaagatactaaaaatcgttttgcatctgaatcagtttataatgcg
attaagtttgataagacagttggtgtcattaatgaagataaaattcaagggaaggttgaa
ttggctgcaccacttggcgtgttagctggtatcgtaccaaccacgaatccaacatcaaca
acaatctttaagtcaatgttaacagcaaagacacgtaatacaattatctttgctttccac
ccacaagcgcagaaatcatcagcacatgcagcccagatcgtttatgaagctgcagttaag
gctggcgcaccaaagaactttatccaatggattgagaagccctcaatttatggtacaagt
gctttaatccaaaatacaggcatcgcctcaattttggctaccggtggtccttcaatggtc
aatgcagcgttgaaatcaggaaacccatcaatgggtgttggtgcaggaaacggcgcaatt
tatcttgatgcaactgtggatacagatcgtgcagtttctgacttactattatcaaaacgt
tttgataatggtatgatctgtgccacagaaaactcagcagtcattcaatcaccaatttat
gatgaagtactaaaaaagttgcaagatcaaggcgcttacttagttcctaagaaagattac
aagaaaattgctgactatgtcttcaaagcaaatgccgaaggttacggtgttgctggaccg
gttgctggtatgtcaggacgctggattgctgagcaagctggtgttaaagtacccgaaggc
aaagatgttttgctgtttgaattagatcaaaaaaatattggtgaagcattgtcttcagaa
aagttatcaccattgctttctatttataaagtcgaaaagcgccaagaagctattgataca
gtgcaatctttgttaaattatcaaggtgctggtcacaatgcggctattcaaattggttca
caagatgatccatttattaaagaatatgctgatgctattggggcatcacgtatcttggtt
aaccaacctgactcaattggtggcgttggcgatatttatacagatgctatgcgcccatca
ttgacgcttggtaccggatcatgggggaaaaattcattgtctcataacttatcaacatat
gatttgcttaacattaaaacagtagctcgccgtcgtaaccgcccacagtgggtacgacta
ccaaaagaagtttactatgaatcaaatgcgattacttatttacaagatttaccttcaatc
aatcgtgctttcattgtagctgatcctggtatggtacaatttggattcgttggtaaagtt
ctgagtcagttagaactccgtcaagaacaagttgaaacaaatatttacggttcagttaaa
ccagatccaaccttgtcacaagctgtggatattgctcgccaaatggctgctttcaagcct
gatacagttatcctactaggtggtggttcagcacttgacgccggtaagattggtcgcttc
ttgtacgagtattcaacacgtaacgaaggtattttggaggatgaagagcaaatcaaagcg
ttattcatggaattgcaacagaagttcatggatattcgtaagcgtattgtaaaattctat
catgcacgtttgacacaaatggtggccattccaactacctcaggtacaggttctgaagta
acaccatttgctgtgattactgatgatacaactcatgtgaagtacccattggccgactac
gaattgacacctgaagttgcgattgttgaccctgagtttgttatgacagtgccaaagcgt
accgttgctttctctggactagatgccttgtctcatgctttggagtcatacgtgtcagtg
atggcatcagaattcacacgcccttgggctttgcaagctattaagttgatttttgataac
ttagcagaatcataccgttacgatccaaagaacccgactaaagaaggtcaaacagcacgt
acaaagatgcactacgcctcaacattggctggtatgtcatttgccaatgccttcttaggt
attaatcattctttggcacataaagttggtggtgaatttgaattaccacacggattggct
attgctattgcgatgccacatgttattaagtttaatgcggtcacaggtaacgttaagcgt
acgccttacccacgttatgaaacttacacagcgcaaaaagattacgccgatattgcacgt
catattggtttgaagggcagcacggatgctgaattagttgatgctttgattacagccatt
aagaagttggctaagtcagttgaagttgatcagacactaactggtaacggcgttaaaaag
gcagatttggaacgtaacattgatgcgttgacagatcttgtctataatgaccagtgcaca
cctggtaacccacgccaaccaagtttggatgaaattaagcaattattgagagatcaatta
taa

DBGET integrated database retrieval system