KEGG   Leuconostoc carnosum: C270_00220Help
Entry
C270_00220        CDS       T02321                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    C270_00220
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_00220
   00620 Pyruvate metabolism
    C270_00220
   00650 Butanoate metabolism
    C270_00220
  Lipid metabolism
   00071 Fatty acid degradation
    C270_00220
  Amino acid metabolism
   00350 Tyrosine metabolism
    C270_00220
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C270_00220
   00626 Naphthalene degradation
    C270_00220
Enzymes [BR:lcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C270_00220
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     C270_00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55210..57912
Genome map
AA seq 900 aa AA seqDB search
MANATEKKPEKKVLTPEEKANLQAQAEKMTAELVKKSQQALAEFSTFTQEQVDTIVAAMA
LAGSQNSLVLAHEAHDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVINEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKSSAHAAQIVYEAAVK
AGAPKNFIQWIEKPSIYGTSALIQNTGIASILATGGPSMVNAALKSGNPSMGVGAGNGAI
YLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQSPIYDEVLKKLQDQGAYLVPKKDY
KKIADYVFKANAEGYGVAGPVAGMSGRWIAEQAGVKVPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKRQEAIDTVQSLLNYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWVRL
PKEVYYESNAITYLQDLPSINRAFIVADPGMVQFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSQAVDIARQMAAFKPDTVILLGGGSALDAGKIGRFLYEYSTRNEGILEDEEQIKA
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDTTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHALESYVSVMASEFTRPWALQAIKLIFDN
LAESYRYDPKNPTKEGQTARTKMHYASTLAGMSFANAFLGINHSLAHKVGGEFELPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARHIGLKGSTDAELVDALITAI
KKLAKSVEVDQTLTGNGVKKADLERNIDALTDLVYNDQCTPGNPRQPSLDEIKQLLRDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgcaactgaaaagaaacctgaaaaaaaggttttaacaccagaagaaaaggca
aatttacaagcacaagctgaaaaaatgactgccgagttagttaaaaaatcacaacaggcg
ttagcagaattttcaactttcacacaagaacaagttgatacaattgtggcggctatggcg
ttagctggttcgcaaaattcattggtattggctcacgaagcacatgatgaaactggtcgt
ggtgtggttgaagataaagatactaaaaatcgttttgcatctgaatcagtttataatgcg
attaagtttgataagacagttggtgtcattaatgaagataaaattcaagggaaggttgaa
ttggctgcaccacttggcgtgttagctggtatcgtaccaaccacgaatccaacatcaaca
acaatctttaagtcaatgttaacagcaaagacacgtaatacaattatctttgctttccac
ccacaagcgcagaaatcatcagcacatgcagcccagatcgtttatgaagctgcagttaag
gctggcgcaccaaagaactttatccaatggattgagaagccctcaatttatggtacaagt
gctttaatccaaaatacaggcatcgcctcaattttggctaccggtggtccttcaatggtc
aatgcagcgttgaaatcaggaaacccatcaatgggtgttggtgcaggaaacggcgcaatt
tatcttgatgcaactgtggatacagatcgtgcagtttctgacttactattatcaaaacgt
tttgataatggtatgatctgtgccacagaaaactcagcagtcattcaatcaccaatttat
gatgaagtactaaaaaagttgcaagatcaaggcgcttacttagttcctaagaaagattac
aagaaaattgctgactatgtcttcaaagcaaatgccgaaggttacggtgttgctggaccg
gttgctggtatgtcaggacgctggattgctgagcaagctggtgttaaagtacccgaaggc
aaagatgttttgctgtttgaattagatcaaaaaaatattggtgaagcattgtcttcagaa
aagttatcaccattgctttctatttataaagtcgaaaagcgccaagaagctattgataca
gtgcaatctttgttaaattatcaaggtgctggtcacaatgcggctattcaaattggttca
caagatgatccatttattaaagaatatgctgatgctattggggcatcacgtatcttggtt
aaccaacctgactcaattggtggcgttggcgatatttatacagatgctatgcgcccatca
ttgacgcttggtaccggatcatgggggaaaaattcattgtctcataacttatcaacatat
gatttgcttaacattaaaacagtagctcgccgtcgtaaccgcccacagtgggtacgacta
ccaaaagaagtttactatgaatcaaatgcgattacttatttacaagatttaccttcaatc
aatcgtgctttcattgtagctgatcctggtatggtacaatttggattcgttggtaaagtt
ctgagtcagttagaactccgtcaagaacaagttgaaacaaatatttacggttcagttaaa
ccagatccaaccttgtcacaagctgtggatattgctcgccaaatggctgctttcaagcct
gatacagttatcctactaggtggtggttcagcacttgacgccggtaagattggtcgcttc
ttgtacgagtattcaacacgtaacgaaggtattttggaggatgaagagcaaatcaaagcg
ttattcatggaattgcaacagaagttcatggatattcgtaagcgtattgtaaaattctat
catgcacgtttgacacaaatggtggccattccaactacctcaggtacaggttctgaagta
acaccatttgctgtgattactgatgatacaactcatgtgaagtacccattggccgactac
gaattgacacctgaagttgcgattgttgaccctgagtttgttatgacagtgccaaagcgt
accgttgctttctctggactagatgccttgtctcatgctttggagtcatacgtgtcagtg
atggcatcagaattcacacgcccttgggctttgcaagctattaagttgatttttgataac
ttagcagaatcataccgttacgatccaaagaacccgactaaagaaggtcaaacagcacgt
acaaagatgcactacgcctcaacattggctggtatgtcatttgccaatgccttcttaggt
attaatcattctttggcacataaagttggtggtgaatttgaattaccacacggattggct
attgctattgcgatgccacatgttattaagtttaatgcggtcacaggtaacgttaagcgt
acgccttacccacgttatgaaacttacacagcgcaaaaagattacgccgatattgcacgt
catattggtttgaagggcagcacggatgctgaattagttgatgctttgattacagccatt
aagaagttggctaagtcagttgaagttgatcagacactaactggtaacggcgttaaaaag
gcagatttggaacgtaacattgatgcgttgacagatcttgtctataatgaccagtgcaca
cctggtaacccacgccaaccaagtttggatgaaattaagcaattattgagagatcaatta
taa

DBGET integrated database retrieval system