KEGG   Leuconostoc carnosum: C270_01150Help
Entry
C270_01150        CDS       T02321                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lcn  Leuconostoc carnosum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lcn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249987..250592
Genome map
AA seq 201 aa AA seqDB search
MDYPEPIAKLIDNYTKLPGIGVKTATRLAFYTLGMDETDVFDFSKALTSAKQDLTFCEIC
GNITEKNVNPCVICQDDSRDQSTIFVVENSRDVMAMENTRDYHGLYHVLNGIISPSAGTG
PEDINLPSLIRRLSEHQEINEVIVGTNVNAEGEATAMYLARLLKPAGLKVTRLAHGLAVG
SDIDYADQLTLIKAVQGRTEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggattatccagaacctattgcaaaattaatcgataattataccaaattaccaggcatt
ggtgtgaaaacagctacacgcttagccttttataccttaggtatggatgaaaccgatgtt
tttgatttttcaaaggccctcacgagtgctaaacaagatctgacattttgtgaaatctgt
ggcaatattacagaaaaaaatgttaacccatgtgtgatttgccaggatgattcgcgtgac
caatccacgatttttgtggttgaaaactcacgcgatgtcatggccatggaaaatactcgt
gactatcatggtttgtaccatgtcttgaatggtattatttcaccaagtgcaggaacaggc
ccagaagacattaatttacctagtcttatccgacgtttatcagagcatcaagaaattaat
gaagtgattgttgggaccaatgtcaatgctgaaggtgaggcgactgccatgtatttagca
cgcctgctgaagcctgctgggttaaaagtgacaaggttagcacatggactagctgttggt
tctgatattgactacgctgatcaattaacgttaattaaggctgtgcaaggacgaacagaa
ttatga

DBGET integrated database retrieval system