KEGG   Leuconostoc carnosum: C270_01410Help
Entry
C270_01410        CDS       T02321                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lcn  Leuconostoc carnosum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    C270_01410
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C270_01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
302953..303555
Genome map
AA seq 200 aa AA seqDB search
MAQLFFEYGAMSSGKSIEILKVAHNYESQGRKVLLMTPIVDTRAGVGIVASRMGLSRQAV
AVKPEADLYQLIKSMKDDNLAVVLIDEAQFLAAEQVDQLAHVVDNLHIPVMTFGLKQDAF
NHLFEGSKRLIELADKLEEMKTICSFCGKKATTQLRIVDGKPQREGAQVFIGGDEAYIPT
CRRHWFNPDLAKIADMFPVK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattattctttgaatacggcgcaatgagttcaggaaaatcgattgagatttta
aaagttgcacataattatgaatcgcaagggcgcaaagtattattgatgacgccaattgtt
gatacgcgtgctggggtggggattgttgctagtcgtatgggactgtcacggcaggcggtt
gcggttaaacctgaggccgatttatatcagctgatcaaaagcatgaaagatgataattta
gccgttgtcttaattgacgaggcacaatttcttgctgctgaacaggttgatcaattggct
catgttgttgacaatttacacattccagttatgacttttggtttaaaacaagatgccttc
aaccatctgtttgaaggctctaaacgattgattgagctagctgataaattagaagaaatg
aaaacaatttgttccttttgtggtaaaaaggcaaccacacagctacgcattgttgatggt
aaaccgcagcgtgaaggggcgcaagtgtttattggtggcgatgaagcctatattccaacc
tgtcgtcggcattggttcaatccagatttagctaaaatagctgatatgtttcctgttaaa
taa

DBGET integrated database retrieval system