KEGG   Leuconostoc carnosum: C270_02220Help
Entry
C270_02220        CDS       T02321                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_02220
Enzymes [BR:lcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     C270_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464785..466221
Genome map
AA seq 478 aa AA seqDB search
MSNGLSKEFLWGGAVAAHQLEGGWQEGGKGLSVADVMTVGKPGQERGITDGIISGEYYPN
HEAIDFYHHYKEDIALLKEMGFKCFRTSIAWTRIYPTGEESEPNEAGLKFYDDLFDELLA
NDIEPVITLSHFELPYHLVTEYGGFRNRQVIDLFVKFAETCFKRYQDKVKYWMTFNEINN
QANYDSDFLVFTNSGLRFKPGENREEGMYQAAHNELVASARAVKLGHDINPDFQIGCMIA
MGPVYPATMNPDDVLAAQKAMEKNYFFADVHVNGVYPDFLTKYWARKGFNINITAEDEAD
LKSGTVDYIGFSYYMSHAVKKDSEIAFDDMTPQNSQVRNTYLEASDWGWQIDPKGLRYAL
NWFTDKYHLPLFIVENGFGAYDKVAEDGAVHDDYRIDYLREHIRQMKLAVVEDGVDLIGY
TPWGCIDLVSAGTGEMDKRYGFIYVDKNNKNEGTLKRSKKDSFDWFKEVIASNGENLD
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacggtttatcgaaagaatttctttggggtggcgctgttgcagctcaccaatta
gaaggtggttggcaagaaggtggcaagggactgagcgtggctgatgtcatgacagtgggt
aagccaggtcaagaacgtggcattacagatggtattatttcaggagagtactatcctaac
cacgaagcaatcgatttttatcatcattataaagaagatattgcactcttgaaagagatg
ggatttaaatgtttccggacatctattgcctggacaagaatatatcctacaggggaagaa
agtgaaccaaatgaagcaggattaaaattttacgatgatttgtttgatgaacttttggca
aatgacattgagccagttattacattatcgcatttcgaattgccttatcatttagtgact
gaatatggtggattccgtaatcgacaggtgattgatttatttgttaaattcgctgagact
tgtttcaaacgttatcaagataaagttaaatattggatgacttttaatgaaattaataac
caagcaaattatgatagtgatttcttggtatttactaattctggtctgcgatttaaacca
ggtgaaaaccgagaggagggtatgtaccaagcggcacataatgagttggtagctagtgca
cgggcggttaaattaggtcatgatattaatcctgattttcagattggctgcatgattgcc
atgggaccagtatatcctgcaacaatgaatcctgatgatgttttggcggctcagaaagcg
atggaaaaaaattatttctttgctgatgtgcatgttaatggcgtttatccagacttttta
acaaaatattgggcacgtaagggatttaatattaatataacggcagaagatgaggccgat
ttaaaatcagggacagtcgattatattggttttagttactatatgtcacatgctgttaag
aaagatagtgaaatagcatttgatgatatgacgccacaaaatagtcaagtacgtaatacc
tacttagaggcaagtgattgggggtggcaaattgatccaaaagggttacgctatgcatta
aattggtttactgataaataccatctgcctttatttattgttgaaaatgggtttggtgct
tatgataaagtcgcagaagatggggccgtgcatgatgattatcgtattgactatctacgt
gagcatattcgtcaaatgaagttagctgttgtagaagacggtgttgatttgattggatat
acaccttggggctgcattgatttggtatcagctggaacaggagaaatggataagcgttat
ggctttatctatgtcgataaaaataataaaaatgaaggaacactaaaacgtagcaaaaaa
gactcgtttgattggtttaaagaagttatcgcatccaatggtgaaaacttagattag

DBGET integrated database retrieval system