KEGG   Leuconostoc carnosum: C270_02450Help
Entry
C270_02450        CDS       T02321                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00040  Pentose and glucuronate interconversions
lcn00052  Galactose metabolism
lcn00500  Starch and sucrose metabolism
lcn00520  Amino sugar and nucleotide sugar metabolism
lcn01100  Metabolic pathways
lcn01130  Biosynthesis of antibiotics
Module
lcn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C270_02450
   00052 Galactose metabolism
    C270_02450
   00500 Starch and sucrose metabolism
    C270_02450
   00520 Amino sugar and nucleotide sugar metabolism
    C270_02450
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     C270_02450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFT81403
UniProt: K0D9B6
Position
507396..508268
Genome map
AA seq 290 aa AA seqDB search
MKPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIASGIEDIVIVDGKS
KRSIEDHFDSNPELENNLREKGKEELLKVVEETTDINMYFIRQSHPKGLGDAVLTAKAFI
GDEPFVVLLGDDLMEDDVPLTKQLIQRYEETGESTLAVMQVPRDQVSEYGVIDPAAEASD
GLYRVKSFVEKPKPEDAPSNLAIIGRYLLTPEIFEELENTQPGKGNEIQLTDAIDSLNNR
QHVYAHEFKGNRYDIGSKIGFLETNIEFGLKHPQTKDKLRAYIKEIASKL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtacgtaaagcaattattcccgcagccggattaggcacacgttttttgcca
gctacaaaggcattggcaaaggaaatgttaccaattgttgacacaccaacaattgaatat
atcgttcgtgaagcaattgcctcaggtattgaagatattgtcattgttgatggtaagtca
aagcgatcaattgaagatcattttgactcaaaccctgagttggaaaataatttacgagaa
aaaggcaaggaagagctgttaaaggtagtcgaagaaacaacagatatcaatatgtacttc
attcgccaatcacatcctaagggcttgggggatgctgttctaacagcgaaagcatttatt
ggcgatgaaccatttgttgttctcctcggtgatgatttaatggaagatgatgtaccacta
acaaagcagttgatacaacgttatgaagaaactggtgaatcaaccttggcagtgatgcaa
gtaccacgtgatcaggtctcagaatatggtgttattgatccagccgccgaagcatctgac
ggactgtaccgcgttaagtcatttgttgaaaagccaaagcccgaggatgcaccatcaaac
ttagctattatcggtcgttatttgttaacaccagaaatttttgaagagttagaaaataca
caacctggtaagggaaatgaaatccagttaactgatgctattgattcattaaataatcgt
caacatgtttacgcgcatgaatttaagggtaatcgttatgatattggatcaaagattggc
tttttggaaactaatattgagtttggcttaaagcaccctcaaacaaaagataagttacgt
gcctatattaaagaaatcgcttcaaaattataa

DBGET integrated database retrieval system