KEGG   Leuconostoc carnosum: C270_02465Help
Entry
C270_02465        CDS       T02321                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lcn  Leuconostoc carnosum
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lcn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
510926..512377
Genome map
AA seq 483 aa AA seqDB search
MKKLTNEAMLITYADSLGKNLKELNQVLSNELDGVVGGVHVLPFFPSTGDRGFAPEEYET
VDPKFGDWFDIDKLADKYYLMFDFMLNHISPQSKYFQDFLEKKEESEYYDMFLKYSEFWP
ENRPTEADIDMIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQMDLDVTKEVTKKFIKDSL
VNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWEILDEVRAILTAEGSEVLPEIHEHY
TIVRKITEHDMYSYDFALPLITLYSLYSGKTNRIADWLRQSPMKQFTTLDTHDGIGVVDA
KDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQINTTYYSALGNNDASYLLARA
TQIFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLAEIAETTKRPVVSNLFDL
LRFRNTSAAFDLDGSIEVVNNGENELTVTRTSADGKTTATLDANFATKEFTVTENGEEIF
ATK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcttacaaatgaagcgatgcttatcacatatgctgattcactcggtaagaac
ttgaaggaattaaaccaagttttgtcaaacgaattggatggtgttgttggtggtgtgcac
gtcttaccattcttcccatcaacaggggatcgcggatttgcacctgaagaatatgaaaca
gttgacccaaagtttggtgactggtttgacatcgataagttggcagataagtactacttg
atgtttgattttatgttgaaccatatttcaccacaatcaaagtacttccaagactttttg
gaaaagaaagaggaatcagaatattatgacatgttcttgaagtattctgaattctggcca
gaaaaccgcccaactgaagcggatattgacatgatttacaagcgtaaggataaagcacca
tttgcacctgttactttcgctgacggcacaacagatcaagtttggaatacatttggtgat
caacaaatggatttggatgtaaccaaagaagttacaaaaaagttcatcaaggattcatta
gttaacttggcacatcatggtgcttctgttatccgtttagatgcctttgcttatgctatt
aagaagttggatacaaacgatttcttcgttgaacctgaaatttgggaaatattagatgaa
gtccgtgctatcttaactgctgaaggttcagaagttttgcctgaaattcatgaacattac
actattgttcgtaagattacagaacatgacatgtattcatatgactttgctttgccattg
attacattgtattcattgtactcaggtaagacgaatcgcattgctgactggttgcgtcaa
agcccaatgaagcaattcacaacattagacacgcatgatggtattggtgttgttgatgct
aaggacttgttgacacaagaagaaactgactttactactgaagaaatgtacaaagttggt
gctaatgttaagaagattttctcttcagcagcatacaataacttggatatttaccaaatt
aatacaacttactattcagcattgggtaacaacgatgcatcatacttgctagcccgtgca
acacaaattttcgcacctggtattccacaaatttactatgttggtttacttgctggtgaa
aatgatattgaattattagaaagttcaaaagaaggtcgtaatatcaaccgtcattattat
gatttggctgaaattgctgaaacaacaaagcgtcctgttgtttcaaacttgtttgatcta
ttgcgtttccgtaacacaagtgctgcctttgacttggatggttcaatcgaagttgttaac
aacggcgaaaatgaattaactgttacacgtacatcagcagatggtaagacaactgccaca
ctagatgctaactttgcaactaaagaattcactgtgactgaaaatggtgaagaaattttt
gcaacaaagtaa

DBGET integrated database retrieval system