KEGG   Leuconostoc carnosum: C270_02930Help
Entry
C270_02930        CDS       T02321                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00010  Glycolysis / Gluconeogenesis
lcn00052  Galactose metabolism
lcn00500  Starch and sucrose metabolism
lcn00520  Amino sugar and nucleotide sugar metabolism
lcn00521  Streptomycin biosynthesis
lcn01100  Metabolic pathways
lcn01110  Biosynthesis of secondary metabolites
lcn01120  Microbial metabolism in diverse environments
lcn01130  Biosynthesis of antibiotics
lcn01200  Carbon metabolism
Module
lcn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_02930
   00052 Galactose metabolism
    C270_02930
   00500 Starch and sucrose metabolism
    C270_02930
   00520 Amino sugar and nucleotide sugar metabolism
    C270_02930
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    C270_02930
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    C270_02930
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     C270_02930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFT81499
UniProt: K0D6H7
Position
609864..610823
Genome map
AA seq 319 aa AA seqDB search
MIKDKLIGVDLGGTTIKFAILTQEGEIQQKWSIKTNIFDDGSHIVPDIVDSINHHLDMYQ
LDRERVIGIGMGTPGTVNRTAGTVTGAFNLNWKTEQTVKADIEAGTGLTLTLENDANSAA
LGEAWKGAGNNDDEVSFITLGTGVGGGLVANGRLIHGTAGAGGEVGHVVVEPNGYLCTCG
NKGCLEQYASATGVVHLAQDFAEEYVGSSQLKQLIANGDEVTSKIVFDLAKEGDFLANEV
VNKVAYYLGYAVAAMSNMLNPSAVVIGGGVAAAGEFLRARVENQWEAFAFPTVRTSTRVK
LAELGNDAGVIGAASLARI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagacaaattaataggcgttgatttaggtggtacaacaatcaagtttgcgatt
ttgacacaagaaggtgaaattcaacaaaagtggtcaattaagactaatatttttgatgat
ggctcacacattgtgccggatattgtagattcaattaatcatcacctagatatgtatcaa
cttgatcgtgagcgtgttattggtatcggtatgggaacacccggtacagtaaaccgcacg
gcaggtacagttaccggtgcttttaatttaaattggaaaacagaacaaactgtaaaagct
gatatcgaagccggtaccggcttaacattgacacttgaaaacgatgctaactcagcagca
cttggtgaggcctggaaaggtgccggcaacaatgatgatgaagtatcgtttattacacta
ggtactggcgttggtggtggattagttgcaaatggtcgattgattcatggtacagctggt
gctggtggcgaagtcggtcatgttgttgttgaacctaatggttatttgtgtacatgtggt
aacaaaggttgcttggaacaatatgcttcagcaactggtgtcgttcatttggcacaagac
tttgctgaagagtatgttggttcatctcaattgaagcaattaattgcaaatggtgatgaa
gttacatctaaaattgtatttgatttagctaaggaaggtgatttcttagctaatgaagta
gtcaacaaagtagcttactatttgggttatgctgttgcagcaatgtcaaatatgttgaac
ccatcagcagtcgttattggtggtggtgtggcagctgcgggtgaattcttacgtgctcgt
gttgaaaaccagtgggaggcatttgcctttccgacagttcgtacgtcaactcgtgtgaag
ttagctgaattgggtaacgatgctggtgttatcggtgcagcttcattagcacgtatttaa

DBGET integrated database retrieval system