KEGG   Leuconostoc carnosum: C270_02930Help
Entry
C270_02930        CDS       T02321                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C270_02930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_02930
   00052 Galactose metabolism
    C270_02930
   00500 Starch and sucrose metabolism
    C270_02930
   00520 Amino sugar and nucleotide sugar metabolism
    C270_02930
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    C270_02930
   00524 Butirosin and neomycin biosynthesis
    C270_02930
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     C270_02930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
609864..610823
Genome map
AA seq 319 aa AA seqDB search
MIKDKLIGVDLGGTTIKFAILTQEGEIQQKWSIKTNIFDDGSHIVPDIVDSINHHLDMYQ
LDRERVIGIGMGTPGTVNRTAGTVTGAFNLNWKTEQTVKADIEAGTGLTLTLENDANSAA
LGEAWKGAGNNDDEVSFITLGTGVGGGLVANGRLIHGTAGAGGEVGHVVVEPNGYLCTCG
NKGCLEQYASATGVVHLAQDFAEEYVGSSQLKQLIANGDEVTSKIVFDLAKEGDFLANEV
VNKVAYYLGYAVAAMSNMLNPSAVVIGGGVAAAGEFLRARVENQWEAFAFPTVRTSTRVK
LAELGNDAGVIGAASLARI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagacaaattaataggcgttgatttaggtggtacaacaatcaagtttgcgatt
ttgacacaagaaggtgaaattcaacaaaagtggtcaattaagactaatatttttgatgat
ggctcacacattgtgccggatattgtagattcaattaatcatcacctagatatgtatcaa
cttgatcgtgagcgtgttattggtatcggtatgggaacacccggtacagtaaaccgcacg
gcaggtacagttaccggtgcttttaatttaaattggaaaacagaacaaactgtaaaagct
gatatcgaagccggtaccggcttaacattgacacttgaaaacgatgctaactcagcagca
cttggtgaggcctggaaaggtgccggcaacaatgatgatgaagtatcgtttattacacta
ggtactggcgttggtggtggattagttgcaaatggtcgattgattcatggtacagctggt
gctggtggcgaagtcggtcatgttgttgttgaacctaatggttatttgtgtacatgtggt
aacaaaggttgcttggaacaatatgcttcagcaactggtgtcgttcatttggcacaagac
tttgctgaagagtatgttggttcatctcaattgaagcaattaattgcaaatggtgatgaa
gttacatctaaaattgtatttgatttagctaaggaaggtgatttcttagctaatgaagta
gtcaacaaagtagcttactatttgggttatgctgttgcagcaatgtcaaatatgttgaac
ccatcagcagtcgttattggtggtggtgtggcagctgcgggtgaattcttacgtgctcgt
gttgaaaaccagtgggaggcatttgcctttccgacagttcgtacgtcaactcgtgtgaag
ttagctgaattgggtaacgatgctggtgttatcggtgcagcttcattagcacgtatttaa

DBGET integrated database retrieval system