KEGG   Leuconostoc carnosum: C270_03400Help
Entry
C270_03400        CDS       T02321                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcn  Leuconostoc carnosum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lcn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lcn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709757..711232
Genome map
AA seq 491 aa AA seqDB search
MQITSETIEQLLNEHNLLVSKPKNRMTFNFLHYDTRQVKDNTLFVVKGAFKIEYLNDING
VTGLITEKILNLPQPQWLVTNVQKALSILSMAFFDYPQNQLWIGAFTGTKGKTTAAYMAY
NILKHATNNHTALFSTVDRITGVTNADKKKSDLTTPESYELFKDMRQAVDNGMTHLIMEV
SSQAYLKQRVYGLRYQVGAFLNISPDHIGPNEHPTFEDYLAHKMMLFDHSDEVIINEESD
HLNDILKHAKKTHDKIYTYSLFENGGDYTYTSQESAIHESRFTVQESDIIEISGRYRLNL
PGDFNESNAMAALIMTSLAGANHQDMLYGLDEVFIPGRMLSLPIAGHGVAFVDYAHNYAS
MRALLSFAQNQYPEGQVLVVVGSPGNKGVSRRADFGRVVSELADVVYLTADDPQYENPLD
IAHQIANYIENDSLEVHFEMDRIQAIHDAIAQAGDKDIVIVAGKGEDPYQKINGVDEPYI
GDYAVVRQYHD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattacaagtgaaacaattgagcaacttttaaacgaacataatcttttagtgtca
aaaccaaaaaataggatgacttttaattttttgcactatgatacgcggcaggttaaagac
aatacactttttgtcgtcaaaggcgcatttaaaattgagtatttaaatgacatcaatggt
gtcacaggtctgattacagaaaaaatcttgaatttaccacaaccacaatggttagtgaca
aatgttcaaaaagcgctatcaattttatccatggcattctttgattatccgcaaaaccag
ttatggattggtgcgtttactggaacaaaaggtaagacaacggcagcctatatggcatat
aatatcttaaagcatgccacaaataatcatactgcgcttttttcaactgttgatcgcatt
actggggtgaccaatgccgataagaaaaaatcagatttgacgacccctgaatcatatgag
ttatttaaagatatgcggcaagcggtagataatggcatgacgcatttaattatggaagtc
agttcacaggcttatctaaagcaacgggtttatggcttgcgatatcaggttggtgcattt
ttaaatatatctcccgaccatatcggtccaaatgagcatccaacatttgaagattattta
gcgcacaaaatgatgttatttgatcattcagatgaggtcataattaacgaggaaagtgat
catctaaatgacatcttaaagcatgccaaaaaaacacatgacaaaatatatacgtacagt
ttgtttgaaaacggtggtgactacacctatacatctcaagaaagtgctatccacgaaagc
cgttttacggttcaagaaagtgatattattgagatttcaggtcgctatcgattaaatcta
cctggagattttaatgaatcaaatgctatggcggcattaattatgacgtcactagctggg
gcgaatcatcaagatatgctttacggcctggatgaagtctttattcctgggcgtatgctg
agtcttcctattgcaggtcatggggtggctttcgtagattatgcgcataattatgcgtcg
atgcgtgccttgcttagttttgcacaaaatcaatatcctgaaggacaggttttggtggtt
gttggttcacctggcaataaaggcgtatctcgtcgagcagattttggccgtgttgtttca
gagctcgctgatgtggtttatttgacagctgatgacccacaatatgaaaatccactagat
attgcgcatcaaatagccaattatattgaaaatgacagtcttgaagttcattttgaaatg
gatcgcattcaagctattcatgacgcaatagcacaagcaggtgataaagatattgttatt
gttgctggtaaaggggaagacccttaccaaaagattaacggcgtggacgaaccatatatt
ggtgattatgcagtagtgcgccaatatcacgattaa

DBGET integrated database retrieval system