KEGG   Leuconostoc carnosum: C270_03605Help
Entry
C270_03605        CDS       T02321                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C270_03605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C270_03605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C270_03605
Enzymes [BR:lcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C270_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
752350..753558
Genome map
AA seq 402 aa AA seqDB search
MANNLSIHNKRGYYGQYGGQFIPELLMPAVEAVADAFNHYKNDPQFKAELQDLFDNYANR
PSLLYHAKCMSDDLGGAQIYFKREDLNHTGAHKINNVLGQALIAKKMGKTRLIAETGAGQ
HGVATATAAALFGMDAEIFMGKEDTDRQALNVYRMKLLGAKVHAVETGTQVLKDAVNATF
QDWTKRIDDTFYVLGSAVGPYPFPEMVKYFQSVISEEARQQFLDQTGKLPDAVIAAVGGG
SNAIGAFAKFIDDPDVTLIGVEAAGKGIHTRETAATIANGSDGIFHGMKSKFLQSNDGQI
DAVYSISAGLDYPGIGPEHAYLADSQRAQYVPITDDEAVTAFEYIARTEGIIAAIESTHA
VAYAMKLAPTMRPDQQIMVNLSGRGDKDVAAIARYKGVNIDE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaacttatcgatacacaacaaacgcggttattacgggcaatatggtggtcaa
ttcattcctgaattgttaatgcctgcagtggaagctgttgctgatgcatttaatcattat
aaaaatgatccgcaatttaaagcagaattacaagatctttttgataattacgccaaccgc
ccatcattactttatcatgctaagtgtatgtccgatgatcttggtggtgcacaaatctat
tttaaacgtgaagatttgaatcacacgggcgctcataaaattaacaatgttttgggtcaa
gctttgattgctaaaaaaatgggaaaaacgcgtttaatagctgaaactggtgctgggcaa
catggtgttgcgacagctactgctgctgcattgtttggcatggatgctgaaatatttatg
ggtaaagaagatacggatagacaagctttaaatgtttatcgtatgaagttacttggtgct
aaagtacatgccgtagaaactggaacacaggtattaaaagatgctgttaacgcaacattt
caagactggacgaagcgaattgatgatacattttatgtacttgggtcagcagttggacca
tatccttttcctgaaatggttaagtatttccaatcagtgattagtgaagaagcgcgtcaa
caatttttagatcagactggcaaattgccggatgctgtgattgctgcagtcggtggtggt
tctaatgccattggtgctttcgcaaaatttattgatgatccagatgtcacactaattggt
gttgaagcagctgggaaaggaattcatactagggaaacagcggctacaatcgctaatggt
tctgacggtatttttcacggtatgaaatcaaaatttttacaatcaaatgatgggcaaatt
gatgctgtgtatagcatctcagctggtttagattaccctggtatcggtccagaacatgcc
tatttggcagacagtcaacgtgcacaatatgtgccaattacagatgatgaagcagtaact
gcatttgaatatattgcacgcaccgaagggatcatagcagcaattgaaagtacacatgct
gttgcttatgctatgaaacttgccccaacaatgagaccagatcaacaaattatggttaat
ctcagcggtcgcggtgacaaagatgtagctgctattgctcgatataaaggagttaatatt
gatgagtaa

DBGET integrated database retrieval system