KEGG   Leuconostoc carnosum: C270_03615Help
Entry
C270_03615        CDS       T02321                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lcn  Leuconostoc carnosum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lcn01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lcn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
754573..755358
Genome map
AA seq 261 aa AA seqDB search
MILDELVATTRRNMRKRQQLIPLEALKLQVDKLNIIRVFPFEQALRAPHMSVIAEIKQAS
PSKGQIIPASNFDYISIAKDYEAAQVDLISVLTEEAYFKGSLAILTSVSQSVATPVLRKD
FTIDEYMIYEAKMAGASVILLIVAILDDDQLRAYLDLADKLGLSVIVETHNENEIARAIA
AHAKIIGVNNRNLKDFTVDFNHTQRLRALVPKDVLFIAESGIKTRHDVEQLELVHVNGIL
VGETFMRANDKIAKIRSLFQG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgattttggacgaattagtagcaacaacaagacgcaacatgcgaaaacgacagcaatta
ataccattagaagccttaaaattacaagttgataaactcaacattattcgcgtatttcct
tttgagcaagcgcttagagcaccacatatgtctgttattgctgaaattaaacaagcatcc
ccatcaaaagggcaaatcattccagcatcgaactttgattacatatcgattgctaaagat
tatgaagcagctcaagtggacctgattagtgtattaacagaagaagcatatttcaaagga
tctcttgctatcttaacatctgtctctcagtctgtcgcaacacctgttctccgcaaagat
ttcactattgacgaatatatgatttatgaagcaaagatggcaggtgcatcagttatatta
ttgattgtagctattctagatgatgatcaattaagagcgtatttagatctggctgataaa
ttaggattatcggttattgtggaaacccataatgaaaacgaaattgcacgagcaattgcc
gcacatgccaaaatcattggtgttaataatcgtaatttgaaagatttcacagttgatttt
aaccatacacaacgtttgcgagcattggtaccaaaagatgttttatttatagctgaatca
ggtattaaaacacgtcatgatgttgagcaattagaattagtacatgtgaatggtatttta
gtcggcgaaacctttatgagagccaacgacaaaattgcaaaaattaggtcattatttcaa
ggataa

DBGET integrated database retrieval system