KEGG   Leuconostoc carnosum: C270_03625Help
Entry
C270_03625        CDS       T02321                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C270_03625
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C270_03625
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C270_03625
Enzymes [BR:lcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C270_03625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
756029..756796
Genome map
AA seq 255 aa AA seqDB search
MTVKRIEDVLKSGKGFIGFTVAGDPDFNKSVDYIVTLAEAGADVVEIGIAFSDPSADGPT
IMQADLRAAQSGSTTEKIFSLVEAVRQRTQVPLAFLTYTNPVYKYGYEAFLTKMQALDVQ
GIIMPDMPLEEQSEFVTLAEKYDRSFIQLVTLKSGERIPDIVKRASGFIYVVSSLGITGA
RHKITTAASEVIRQIRRYTDIPTAVGFGISQPEQVAQFHDSEAVIVGSAIVKIIEQHPYD
AEQPLFDFVKRMKNT
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaaaagaatagaagatgttttaaaatcagggaagggattcataggatttact
gtagctggtgatcctgattttaataaaagtgtggattatattgtgactttagcagaagct
ggggctgatgttgtagaaataggaattgctttttctgatccatcagctgatggaccaact
attatgcaggctgatctgcgggctgctcaatctggctcaactactgaaaaaatattttca
ttagttgaagcggttcgtcaacggacacaagtcccacttgcttttctgacctacactaat
cctgtgtataaatatggctacgaggctttcttaacgaaaatgcaggcattggatgttcaa
ggtattattatgccagacatgccacttgaagaacagtcagaatttgtgacgctagcggaa
aaatatgaccgttcatttattcaattagtgacactcaaatctggtgaacgtatccccgat
attgtgaaacgggcgtcaggatttatttatgtagtgagttctcttggtattacaggggcg
cgtcataaaattacgacagcagctagtgaggtaattagacaaattaggcgttacactgat
atcccaacagcggtgggctttggcattagtcagccagagcaagttgcacaatttcatgac
agcgaagcggtaattgttggttcagcaatcgttaaaatcattgaacaacatccttatgat
gctgagcagccattatttgattttgtgaaaagaatgaaaaatacttga

DBGET integrated database retrieval system