KEGG   Leuconostoc carnosum: C270_04460Help
Entry
C270_04460        CDS       T02321                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C270_04460
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C270_04460
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    C270_04460
Enzymes [BR:lcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     C270_04460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(925338..926798)
Genome map
AA seq 486 aa AA seqDB search
MNYVSTRGQAPRVTASQAILAGIAPDGGLYVPESWPTLDLDWSALQNQTYSDIATQVFDA
FFDDFSVSEIDYVIQKAYGKQWANENVVSLHGENNLTYIELFHGPTLAFKDVALQILPHL
MTTAAKKQSQNEKIVILTATSGDTGTAAMSGFGNVDQTEIVVFYPEVGVSDVQRQQMQTE
AATNAHVIAITGNFDDAQKAVKSLLSDEKLIKELQQHHQRFSSANSINIGRLVPQIVYYL
YAYAQLIKKGTIQSGDAINITVPTGNFGNVLAAYYASQIGLPVKEFIVASNENNVLTDFF
ETGTYDRDRAFKVTNAPAMDILVSSNLERLLYFVSGRNSEEVNQYMTSLANDGKYTLTSA
TRSNLDKFTVGFATQTQVLETIRRVAQEENYIIDPHTAVGRYVYDQLKPTGTTLLAATAS
PYKFPQTVLEALNQVPDTGKAGLKQLSDVTQTDIPAQVADLFARPILHKSTIDPEQISRT
LRQEIL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgtgtcaacacgtggccaagcgccaagagttacagcaagccaggcaattttg
gcaggtatcgcgccagatggtgggttatatgtaccagaatcatggccaacactggattta
gattggtcagctttacaaaaccaaacatatagcgatattgcaacgcaagtttttgatgcc
ttttttgatgattttagtgtttctgaaattgattatgttattcagaaagcatatggtaaa
caatgggcgaatgagaatgtcgtatcattgcatggtgaaaataatttaacctatattgaa
ttatttcatggaccaacgttggcttttaaagatgttgctttgcagatattgccacattta
atgacgacagcagctaaaaagcaatcccaaaacgaaaaaattgttattttaacggctacc
tctggtgatacgggaactgctgctatgagtggctttggcaatgtcgaccaaacggaaatt
gtggtcttctatcctgaagttggtgtcagtgatgtacaacgtcagcaaatgcaaacagaa
gctgctactaatgcgcatgtgattgctataactggtaattttgatgatgctcaaaaagct
gttaaatcattattatcagatgagaaattgataaaagaattacaacaacatcatcagcgt
ttttcatcagctaattcaatcaatattgggcgattagtgccacaaattgtttattatttg
tatgcttacgcgcaattaatcaaaaaaggcaccattcaatccggtgatgcgattaatatt
actgtaccaacagggaattttggaaatgtactggctgcatactatgctagccaaattgga
ttgccagtcaaagaatttattgtggcttccaatgaaaataatgtgctaactgattttttt
gaaactggtacttacgatcgtgaccgtgcgtttaaagtaaccaatgcaccagcaatggat
attttagtttcaagtaatttggagcgcttgttgtattttgttagtgggcgtaatagtgaa
gaagtgaaccaatatatgacatcgttagcaaatgatggtaaatatactttgacgtccgca
accagatcgaatttagataagtttaccgttgggtttgcgacacagactcaagtgctagag
acaattagacgtgtggcgcaggaagaaaactacattattgatccacatacagcagttggg
cgttatgtttatgatcaactaaagccaactggtacaactttattggcagcaacagcaagt
ccttataaatttccacaaactgtgttggaggcacttaaccaagttccagatactggaaaa
gcagggttgaaacaattgtctgatgtcacacagactgacataccagctcaagttgcggat
ttatttgctcgaccaattttgcataagagtactattgatccagaacaaatatctcgaaca
ttgcgtcaagaaatcctataa

DBGET integrated database retrieval system