KEGG   Leuconostoc carnosum: C270_04850Help
Entry
C270_04850        CDS       T02321                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lcn  Leuconostoc carnosum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C270_04850
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C270_04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1010556..1011467)
Genome map
AA seq 303 aa AA seqDB search
MSKKIVVLGSLNVDNIMKMPRMPLVGETMALTDVSTAPGGKGANQAVAAARQGADVSFIG
AVGNDTNGQFMRTTLLANGINVDSVMTNGDVPTGSAYIMLQDNGANTILIHGGSNQALTI
SDLNEELIASADTLIAQFEVPLDVITVAFKIAKNNNVQTILNPAPAVYELTPELTAVTDI
ILPNETEAQLLTGLTVENTEEILNQVSDALLEKGVPRSIITLGDAGSFIADGSHRWWQKP
IKVTAEDTTAAGDTFIGTLASVLAPDFSNLDEAVHRASTASAIAVTRQGAIPSIPTRIEV
DSY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaattgttgtacttggtagtttgaatgttgataatattatgaaaatgccg
cgtatgccattagttggggaaacaatggctttaaccgatgttagtactgctcctggtggt
aaaggtgcaaaccaagctgttgctgcagcacgtcaaggggcagatgtatcatttattggg
gctgttgggaatgacaccaacggacaatttatgcgcacaacattacttgccaatgggata
aatgtcgattctgtcatgacaaatggtgatgtaccaactggttcagcttatatcatgtta
caagataatggggccaataccattttaattcatggtggttcaaatcaagcattgacaatt
tctgatttaaacgaggaattaattgctagtgcagatacactgattgcacaatttgaagtg
ccactagatgtcattacggtggcttttaagattgctaaaaataataatgtccagacaata
ctcaatccagcacctgctgtttacgaattaacaccggaattaacagctgtgactgatatc
attttaccaaatgaaactgaggcacaattattaacaggattgacagttgagaatacggaa
gagatccttaatcaagtcagtgatgcgttattagaaaagggcgtaccacgtagtattatc
acattaggagatgcaggatcttttattgctgatgggagtcatcgttggtggcaaaagcca
attaaagtgactgcagaagatacaactgctgcgggtgatacttttattggcacattggcc
agtgttttggcacctgattttagtaaccttgatgaagctgtacatcgcgcaagtactgca
agtgcaatagctgtcacaaggcagggagcgatcccttctattccaacacgtattgaggtt
gatagttattga

DBGET integrated database retrieval system