KEGG   Leuconostoc carnosum: C270_06560Help
Entry
C270_06560        CDS       T02321                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00330  Arginine and proline metabolism
lcn00332  Carbapenem biosynthesis
lcn01100  Metabolic pathways
lcn01130  Biosynthesis of antibiotics
lcn01230  Biosynthesis of amino acids
Module
lcn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    C270_06560
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    C270_06560
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     C270_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DRE2_N
Motif
Other DBs
NCBI-ProteinID: AFT82221
UniProt: K0DE07
Position
complement(1380340..1381155)
Genome map
AA seq 271 aa AA seqDB search
MSVVSKEHRNDNNWRRLVIKVGTSTIVDAKGEIKYPVINRLSQTLTQLQKSGYEVILVTS
GAIGVALQQMKISQRPADIPEQQALAAIGQSYLMAIYNQSFAFYQQHVGQVLLTYDVFDN
KLMLQHTIDAVDVMLAQRVIPIINENDVIAVDELDHQHSFGDNDRLAAIVTHETQADSMI
VLSDIDALYTANPFVDPTAQPISLVSSITQELLDSATGSSTLGTGGMLTKLKAAEYLMQQ
QRQMVLINGANPATILDVVQGKQVGTLFKGE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagtttcaaaagaacaccgtaacgacaataattggcggcgtctagtgatcaaa
gttggtacaagtacaattgtcgacgctaagggtgaaattaagtatcctgtgatcaatcgg
ttgtcgcaaacgttgactcaattacagaaatcaggctacgaagtgattctagtaacttct
ggggctattggggttgccttgcaacaaatgaaaatatctcagcgaccagctgatattcct
gaacaacaagcactagcagccattgggcaaagctatttaatggcgatatataatcaaagt
tttgcattttatcagcaacatgtggggcaagtattattaacttatgatgtttttgataat
aagttaatgctacagcacacaatagatgccgtcgatgtgatgctggcgcaacgtgtgata
ccaattattaatgaaaatgatgtgattgcggttgatgagttagatcatcaacattcattc
ggtgataatgatcggttggctgccattgtgacacatgaaacgcaggctgatagtatgatt
gttttaagcgacattgacgcattgtacactgctaacccatttgtcgatccgacagcccaa
ccaatttcgttggtttcaagtattacgcaggaactattagacagcgctactggttcatct
actttaggcactggtggcatgttgactaaactaaaagcagccgaatatttaatgcagcag
cagcgtcaaatggtattaatcaatggtgctaatccagcaactattttagatgtcgttcaa
ggtaaacaggttggtacgctatttaagggagaataa

DBGET integrated database retrieval system