KEGG   Leuconostoc carnosum: C270_06905Help
Entry
C270_06905        CDS       T02321                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00230  Purine metabolism
lcn01100  Metabolic pathways
Module
lcn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    C270_06905
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     C270_06905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 ABC_tran AAA_28 AAA_24 AAA_14 AAA_23 AAA_16 AAA_33 MMR_HSR1 RsgA_GTPase SRP54 NTPase_1 AAA Thymidylate_kin AAA_30 AAA_5 T2SSE TsaE CoaE AAA_29 Zeta_toxin Sigma54_activat dNK PRO8NT Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: AFT82290
UniProt: K0DBR4
Position
complement(1451978..1452562)
Genome map
AA seq 194 aa AA seqDB search
MKDNKVFVITGATGVGKTTIARYLQENYQMPRVITHTTRSPRDREKAGIAYYFEDDVSFE
RNHYLERVQYAGAQYGSSYEGLERAWEKNPYITIVLDTAGAITYARELGDQVVIIFVTVT
HSDTLIDRVTVRGDDSAAVERRVSSPEFLRDITLPTPLDGVAYELVNDDWSKTKIKLDLL
VNDIMNGRSLPKKN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacaaagtgtttgttattaccggtgccacaggcgttgggaagacgacaatt
gctcgctatttacaagaaaattatcaaatgccgcgcgttattacacatacgactcgttca
ccacgcgaccgtgaaaaggctggcatagcatattattttgaagatgatgtctcatttgaa
cgaaatcactatttagaacgtgtgcaatatgctggtgcacagtatggctcatcctatgaa
ggactagaacgggcatgggagaagaatccatatattactattgtcttagatacagcaggc
gcgattacatatgcacgtgaactgggtgatcaagtggtaattatttttgtgaccgtgaca
cattctgatactttaattgaccgtgtgacagttcgtggggatgattcagctgctgttgag
cggcgcgtatcttcaccagaatttttaagagacattactttaccaacaccgttggatggc
gttgcttatgagttagttaatgacgattggtcgaaaacgaaaatcaagcttgatttatta
gttaatgatattatgaatgggcgtagtttaccaaagaaaaattga

DBGET integrated database retrieval system