KEGG   Leuconostoc carnosum: C270_07225Help
Entry
C270_07225        CDS       T02321                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    C270_07225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_07225
  Lipid metabolism
   00071 Fatty acid degradation
    C270_07225
  Amino acid metabolism
   00350 Tyrosine metabolism
    C270_07225
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C270_07225
   00626 Naphthalene degradation
    C270_07225
Enzymes [BR:lcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C270_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520974..1522029)
Genome map
AA seq 351 aa AA seqDB search
MKAAIVRETPDGYVDLVDNWEPKPLAFGEALVDMEYVGLCHTDLHVASGDFGNPNEIGQR
NGNFRRVVGHEGVGRVSKLAEGASDYLKIGDRVSVAWFYDACGVCDFCVSGNETFCRKVR
NSGYTVDGAMSQQVVVNAQYAVKVPDGLDPVEATSITCAGVTMYKSLKVGETKPGQWVSV
HGAGGLGNLAVQYAHNVFGAHVAVIDGNDDKLAAAKANGAEVLINRKKVADVAEEVQKAT
GGAHTAQVTAVNAAAFNQAVNSLRPMGKLVAVALPQGDMALNIAKTVLDGIEVRGSLVGT
RADLKEAFQFGAEGKVKPIVEKVNFNDMNEVIDEMKAGSITGRKVFDFTTL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaattgtacgtgaaacaccagatggttacgttgatttagtagataattgg
gagccaaagccattagcttttggcgaagccttggttgatatggaatatgttggcttatgc
catacagatttacatgtagctagtggtgactttggtaatccaaatgaaataggacaacgt
aatggtaatttccgtcgtgttgttgggcatgaaggtgttgggcgtgtatcaaaattagct
gaaggcgctagtgattatttaaagattggcgatcgtgtttcagtcgcttggttctacgat
gcttgtggtgtttgtgacttttgtgtttcaggtaatgaaacattttgccgtaaagttcgt
aattctggctatacagttgatggtgcgatgtcacaacaagttgttgttaatgcccagtat
gccgttaaagtaccagatggcttagaccctgttgaggcaacatctatcacatgtgctggt
gtcacaatgtataagtcacttaaagttggtgaaacaaagcctggtcaatgggtttcagtt
catggtgctggtggtttaggtaatttggctgtgcaatatgctcataacgtctttggtgca
cacgtagctgtcattgatgggaatgatgacaagttagcagctgctaaggctaatggcgct
gaagtgttaattaaccgtaaaaaggtagctgatgttgctgaagaagtacaaaaagcaaca
ggtggcgctcacactgcacaagtaactgctgtgaatgcagcagcatttaaccaagctgtt
aactcacttcgcccaatgggaaagttagtagctgtcgctttgccacaaggtgatatggct
ttgaatattgctaagacagttttggatggcattgaagtacgtggttcattagttggtaca
cgtgctgatttgaaggaagctttccaatttggtgctgaaggtaaggtcaagcctattgtt
gaaaaagttaactttaacgatatgaatgaagtaattgatgaaatgaaggctggtagtatt
acaggccgtaaagtatttgatttcacaacactctaa

DBGET integrated database retrieval system