KEGG   Leuconostoc carnosum: C270_07225Help
Entry
C270_07225        CDS       T02321                                 

Definition
(RefSeq) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lcn  Leuconostoc carnosum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    C270_07225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_07225
  Lipid metabolism
   00071 Fatty acid degradation
    C270_07225
  Amino acid metabolism
   00350 Tyrosine metabolism
    C270_07225
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C270_07225
   00626 Naphthalene degradation
    C270_07225
Enzymes [BR:lcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C270_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520974..1522029)
Genome map
AA seq 351 aa AA seqDB search
MKAAIVRETPDGYVDLVDNWEPKPLAFGEALVDMEYVGLCHTDLHVASGDFGNPNEIGQR
NGNFRRVVGHEGVGRVSKLAEGASDYLKIGDRVSVAWFYDACGVCDFCVSGNETFCRKVR
NSGYTVDGAMSQQVVVNAQYAVKVPDGLDPVEATSITCAGVTMYKSLKVGETKPGQWVSV
HGAGGLGNLAVQYAHNVFGAHVAVIDGNDDKLAAAKANGAEVLINRKKVADVAEEVQKAT
GGAHTAQVTAVNAAAFNQAVNSLRPMGKLVAVALPQGDMALNIAKTVLDGIEVRGSLVGT
RADLKEAFQFGAEGKVKPIVEKVNFNDMNEVIDEMKAGSITGRKVFDFTTL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaattgtacgtgaaacaccagatggttacgttgatttagtagataattgg
gagccaaagccattagcttttggcgaagccttggttgatatggaatatgttggcttatgc
catacagatttacatgtagctagtggtgactttggtaatccaaatgaaataggacaacgt
aatggtaatttccgtcgtgttgttgggcatgaaggtgttgggcgtgtatcaaaattagct
gaaggcgctagtgattatttaaagattggcgatcgtgtttcagtcgcttggttctacgat
gcttgtggtgtttgtgacttttgtgtttcaggtaatgaaacattttgccgtaaagttcgt
aattctggctatacagttgatggtgcgatgtcacaacaagttgttgttaatgcccagtat
gccgttaaagtaccagatggcttagaccctgttgaggcaacatctatcacatgtgctggt
gtcacaatgtataagtcacttaaagttggtgaaacaaagcctggtcaatgggtttcagtt
catggtgctggtggtttaggtaatttggctgtgcaatatgctcataacgtctttggtgca
cacgtagctgtcattgatgggaatgatgacaagttagcagctgctaaggctaatggcgct
gaagtgttaattaaccgtaaaaaggtagctgatgttgctgaagaagtacaaaaagcaaca
ggtggcgctcacactgcacaagtaactgctgtgaatgcagcagcatttaaccaagctgtt
aactcacttcgcccaatgggaaagttagtagctgtcgctttgccacaaggtgatatggct
ttgaatattgctaagacagttttggatggcattgaagtacgtggttcattagttggtaca
cgtgctgatttgaaggaagctttccaatttggtgctgaaggtaaggtcaagcctattgtt
gaaaaagttaactttaacgatatgaatgaagtaattgatgaaatgaaggctggtagtatt
acaggccgtaaagtatttgatttcacaacactctaa

DBGET integrated database retrieval system