KEGG   Leuconostoc carnosum: C270_07725Help
Entry
C270_07725        CDS       T02321                                 

Definition
ribokinase RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lcn  Leuconostoc carnosum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C270_07725
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C270_07725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1633075..1634022)
Genome map
AA seq 315 aa AA seqDB search
MNKVVVIGSLNTDLVTKIKRLPAQGETVSVIEQTTNFGGKGANQAVAAARQGADVTFIGA
VGNDDYGLSFKTLLQEESIVTDYIVTKEKPTGMATILLESNGHNTILVNGAANLDLNASD
VKQANQAIAAADIVVAQLEVPTEAIIAGFKIAKNNGAITVLNPAPVTSHLSDELINYTDI
IVPNESEAAALVGSTPSTDIAVIEETIDPELRHKGLKNVIITLGDKGVYYHAAENKGVLP
IFKVAVVDTTAAGDTFIGTLVAYLQEDMSNLRDVLRRSSKASALAVSKAGAITSIPYRSE
VDQGLVSLVDYEVSQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttgttgtcatcggaagtttaaatacagatttagtcactaaaatcaagcga
ctaccggcacaaggcgaaacagtgtctgttatcgaacaaacaaccaactttggtggtaaa
ggtgctaatcaagctgttgctgctgcaaggcaaggcgctgacgttacatttattggtgct
gttggtaatgatgactatggtctctcatttaaaacattacttcaggaagaaagcatagtg
acagattacattgtgactaaagaaaaaccaactggaatggctactattttattagaatca
aatggtcataatacgatactagttaatggggctgctaatctggatttaaatgcatctgat
gttaaacaggcaaatcaagctattgcagctgcagatattgttgtggcacaacttgaagtc
ccaactgaggcaattattgctggatttaaaattgctaaaaataatggggcaatcaccgtt
ctaaatccggcgccagttaccagtcatttaagcgatgaattgattaactatactgacatt
attgtgccaaatgaatcagaagcagcggctttggttggtagtacaccaagtacagacatt
gcggtgatagaggaaacaattgatccagaattacgtcataaaggattgaaaaatgtcatt
atcactttaggtgacaaaggtgtctattatcatgccgcagaaaataaaggtgtgttgcct
atatttaaagtagctgttgttgataccacggctgctggagataccttcattggtacgtta
gtagcctatttacaagaagatatgtcaaatttgcgtgatgtcttgcgacgtagctctaag
gcaagtgctttagcagttagtaaagctggtgcaattacatctattccataccgatcagaa
gttgatcagggactagtttctctggtagattacgaggtttcgcaatga

DBGET integrated database retrieval system