KEGG   Larimichthys crocea (large yellow croaker): 104936922Help
Entry
104936922         CDS       T04659                                 

Gene name
abhd12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104936922 (abhd12)
Peptidases [BR:lco01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   104936922 (abhd12)
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104936922 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 390 aa AA seqDB search
MRKRNNSPTAEHDSGTLLDSDPDLKQRPGRGAAGPAAGGRQGPGEEESMGKPFRRLSLVG
KLKRVLVWLLVVYVSIPIVVKLCPSIQAKLVFLNFVRMPYFIDLKRPLDQGLNHTHNFYL
EPETGLKIGVWHTVPAHMWRDAQGKQGDWYDSTFSSAHHLILYLHGNAGTRGGDHRVQLY
KVLSSLGYHVVTFDYRGWGDSDGSPSEGGMTSDSLFIYDWLKRRLDKKTPLYIWGHSLGT
GVATNLVRRLSDRGSPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDAITANN
IRFASDENVNHISCPVLILHAEDDGVVPFHLGKKLYTMASQSKSLSGHKVQFVPFSSSLA
YKHKFIYRSPELPNILSDFLSTTPQTNDSA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcggaataactcgccgactgcggagcatgacagcggcactctgctggacagc
gacccggacctgaagcagcgtcccggcaggggagcggcagggcccgcagcgggcggccgg
cagggcccgggagaagaggagagcatggggaaaccgttcaggaggttgagtctggtgggg
aagctgaagcgggtcctggtctggctcctggtggtctacgtgtcgatccccatcgtggtc
aaactctgcccgtccatccaggccaaactcgtcttcctcaactttgtgaggatgccgtac
ttcatcgacctgaagcgacccctggaccagggattgaaccacacacacaacttctacctg
gagccagagaccggactgaagattggagtctggcacacggttcccgctcacatgtggaga
gacgctcaggggaaacaaggcgactggtacgactccacgttcagctccgcccaccacctc
atcctctatctccatggaaacgcagggaccagaggaggagaccacagagtccagctgtac
aaggtcctcagttcgttaggataccatgtggttacgtttgattacagaggttggggggat
tcagacggctctccatcagagggcgggatgacatcagactctctcttcatctatgattgg
ctgaaacgacggctggacaagaaaacgccgctttacatctggggacactcgctggggacg
ggagttgctacaaacctggtcagacggctgagtgacagaggaagtcctccagacgctctg
atcctcgagtctccgttcaccaacatcagagaagaagccaagagtcaccccttctccatg
gtgtacaggtacctgcccggcttcgattggttcttcctggacgccatcacagccaacaac
attcgattcgccagcgacgagaacgtgaatcacatttcctgtcccgtgttgatcctccac
gccgaagacgacggagtcgttccgttccacctcggcaagaagctgtacaccatggcgtcc
cagtcaaagagcctgagcggtcataaggttcagttcgtcccgttctcgtcttctctggct
tacaaacataaattcatctacaggagcccggagctgccaaacatcctcagtgattttctc
agcacgactccacagacgaacgactcggcctga

DBGET integrated database retrieval system