KEGG   Lactobacillus crispatus: LCRIS_00153Help
Entry
LCRIS_00153       CDS       T01222                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lcr  Lactobacillus crispatus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lcr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153098..155047
Genome map
AA seq 649 aa AA seqDB search
MCGIVAFYDPKINEKQAVIGKMMAAIKHRGPNSDGYYTNDEVALGFRRLSIIDLRGGSQP
IYNEDKTRAIIFNGEIYNFKPLREELIKAGHVFSTKADTEVLLHGYEEWGMDGLLKRVRG
MFAFLIWDDNNKTLYGARDFFGIKPMYYSNQNGHLLVGSELKSFLEFPKFKRELNVEAVK
PYLMNQYNDLEETFFKGVYRFPAGHWFEYKDGEMKTHQYWDAEYKENNLSFEETLQKINE
DLKETVDLYRNADVKVGAFLSEGIDSSYLTSLLNPDDVFSVSFDDSTYDEASKAKALADI
NHWKFFSDKVDADEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNDIIKVFTSELKKLPEKKRVKLAHKIKRMPNFPGKVHMYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANSILQPTYRNKLTVNGIYQKDFKKVKGVDNVKQMQYID
LHHFMLNDIEQKADKISMAHSLEVRVPYLDKKIAELANSIPTKYLVNRHDTKYALRKASE
KVLPDEWAKRPKLGFPTPIKQWLKEPRFYKQVHALFEEEFVNDIFDQKKIIKLLDDNYEG
DGSHRRQIWTIYTFLVWYKLFFVDYENTVKKYQHVQPEVAKLISQGKLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtggcattttatgatccaaagataaatgaaaaacaagctgttattggt
aaaatgatggctgcaattaaacaccgtggacctaattctgacggttattatactaacgat
gaagttgcccttggctttagaagattgtcaattattgaccttcgtgggggcagtcaacct
atttataacgaagataaaactcgagcaattatttttaatggggaaatttataactttaaa
ccattaagagaagaattaattaaggcaggtcacgtcttttctactaaggccgatactgaa
gtattattgcacggctatgaagaatggggcatggatggcttacttaaacgtgttcgcggg
atgtttgccttccttatttgggatgacaacaacaagaccctttatggtgcacgtgacttc
tttgggattaagccaatgtactacagtaaccaaaatgggcacttgcttgttggttcagaa
cttaagagtttcttggaatttccaaagtttaagcgcgaattaaacgttgaagcagttaag
ccatatttgatgaaccaatacaatgacctagaagaaaccttctttaagggcgtttaccgt
tttccagccggtcattggttcgaatataaagatggcgagatgaagacccaccaatactgg
gatgctgaatataaagaaaataacctttcctttgaagaaactttgcaaaagatcaacgaa
gatttgaaagaaacggttgatttgtatagaaacgctgatgttaaggttggtgctttctta
tcagaaggaatcgactcttcatacttgactagtttgcttaacccagatgacgtgttctca
gtaagttttgatgattcaacttatgatgaagcttctaaggctaaggcattagcagatatt
aatcactggaagttcttcagcgataaggttgatgctgatgaagcaatgcgtgacttccca
gaaatgcaataccacatggatgaaccagatgctaatccgtcaatcattccactctggtac
ttgtgtaaactagctcgtaagcatgttactgttgctctttcaggtgaaggcgctgatgag
ttgtttgctggttatgtgaactacgggatgcatacgcataacgacattattaaggtcttt
acttcagaattgaaaaagttgcctgagaagaagcgggttaaattggcacacaagattaag
agaatgcctaatttcccaggtaaagttcacatgtacaccaatttagctgaaccgagtgaa
ttttatgtcggtcaatcggttatctatgacatggattacccaactatctttacttctaaa
gatgctaatagcattttacagccaacgtatcgcaataaattgactgttaacggcatttac
caaaaagactttaagaaagtaaagggagtcgataatgttaagcagatgcaatacattgac
ttgcaccactttatgcttaacgatattgaacaaaaagctgataagatttcgatggcccat
tcacttgaagttcgtgttccttacctcgacaagaagattgcggaattggctaactctatc
ccaactaagtacttggttaaccgtcatgataccaagtatgctttgcgtaaggcttcagaa
aaagttttaccagatgagtgggctaagagacctaagcttggcttcccaactccaattaag
caatggttgaaggaaccacgtttttacaaacaagttcatgctctttttgaagaagaattc
gttaatgatatttttgaccaaaagaagatcattaagctgcttgatgacaactatgaaggt
gatggctcacaccgtcgtcagatctggactatttacactttccttgtttggtacaagttg
ttctttgttgactatgaaaatacagttaagaagtatcaacacgtgcaacctgaagttgct
aagctaatttcacaaggcaaattactataa

DBGET integrated database retrieval system