KEGG   Lactobacillus crispatus: LCRIS_00190Help
Entry
LCRIS_00190       CDS       T01222                                 

Gene name
gpmA1
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCRIS_00190 (gpmA1)
   01230 Biosynthesis of amino acids
    LCRIS_00190 (gpmA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_00190 (gpmA1)
  Energy metabolism
   00680 Methane metabolism
    LCRIS_00190 (gpmA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCRIS_00190 (gpmA1)
Enzymes [BR:lcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCRIS_00190 (gpmA1)
Exosome [BR:lcr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCRIS_00190 (gpmA1)
  Exosomal proteins of melanoma cells
   LCRIS_00190 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191243..191935
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHFALEESGQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVL
PPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDEDIMNLEMKTGEPVVYTFDENLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattt
actggttgggttgacgttaacctttcagaaaaaggtgttgaagaagctaagaaggctggc
cgtttaatcaaggaacacggtcttgaatttgaccaagcttacacttcattattaactcgt
gctatcaagactttgcactttgcacttgaagaaagtggccaactttggattccagaaact
aagacctggagacttaacgaacgtcactacggtgctttacaaggtttgaacaagaaggct
actgctgaaaagtacggcgatgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgatgacaacgaattcagtcaagcacatgaccgtcgttacgcaaac
ttggacccacacatcgttcctaaggctgaaaacttacacgtatgtcttgatcgtgtaatg
ccattctgggaagaccacattgctccagatttacttgacggcaagaacgtaattatcgca
gctcacggtaactcacttcgtgctttgactaagtacatcgaaaacatttctgatgaagac
attatgaacttggaaatgaagaccggtgaaccagttgtttacacattcgacgaaaacttg
gatgttgttaacaaggaaaagttggacgactaa

DBGET integrated database retrieval system