KEGG   Lactobacillus crispatus: LCRIS_00233Help
Entry
LCRIS_00233       CDS       T01222                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lcr  Lactobacillus crispatus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LCRIS_00233 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCRIS_00233 (murA)
Enzymes [BR:lcr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LCRIS_00233 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240420..241715
Genome map
AA seq 431 aa AA seqDB search
MKQMIIHGGKPLQGDVWIGGAKNSTVALIPASILSRTPVTLEGVPRIADVVNLMDLLSEM
DVHCDFGETTLRIDPTDIKMSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDIGP
RPIDQHIKGFEALGASVKNENDQIIITAPEDGLHGAKIHLKMPSVGATMNIIMASVTAQG
QTIIENAAKEPEIIDLATFLNNMGAVIRGAGTDSIRIEGVEQLKAQIPHTIIPDRIEAGT
YVALAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVIDSDEDSLYVYPAGDLKMVQVKTDV
YPGFATDLQQPITPLLLTAKSGEGVVIDNIYPKRIGHIAQLQKMGANIKVEDNIILAHPT
KQFHGAEVTAGEIRAGACLMIAGLMADGTTTIDKAGNILRGYDRVQEKLRQLGADVTIKD
DPAVPGILDNI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagatgataattcatggtggaaagcccctgcagggtgatgtttggatcggtgga
gctaagaactcaacagttgctcttattccggcatcaattttatcaagaacaccagtgacc
ttggaaggcgtcccaagaatagctgatgtggttaacttgatggacttgttaagtgagatg
gatgtacattgtgatttcggtgaaaccactttaagaatagatccaactgatatcaaaatg
agtccgttgccagctggtaagattaagagtttgcgcgcttcatattactttatgggtgcg
ctacttggtcgctttggcaaggcagtagtgggcttccctggtggtgacgatattgggcca
cgtccgattgaccaacatattaagggctttgaagccttaggcgctagcgtaaaaaatgaa
aatgatcaaattataattactgcaccagaagatggtttgcatggagcaaaaattcattta
aagatgccatcagttggggcaacgatgaatattattatggctagtgtgacggcacagggc
cagactataatcgaaaatgccgcaaaggaaccggaaattattgatttagctaccttcttg
aacaatatgggggcagttattcgtggtgctggtactgactctattcgaattgaaggggtg
gagcagcttaaagcacagattcctcatacgattattccagacagaattgaagcagggact
tatgttgctttagctgcctgtattggtaatggcattcgcattcataatattatcgaagaa
caccttgattcatacctggctaaagttgaagaaatgggtgtagtaatcgattcagatgaa
gattctttgtatgtttacccagcgggcgacctaaaaatggtccaggtgaagacagatgtt
tatcctggttttgcgacagatttacagcaaccaattacaccacttttattaactgctaaa
agcggtgaaggtgtagtaatcgataatatttatcctaaacggattggtcatattgctcag
ttgcaaaagatgggagccaatattaaagttgaagataatattattttggcccatccaact
aagcagtttcatggtgcggaagtaactgcaggtgagattcgggcaggtgcctgtctgatg
attgcaggactgatggctgatggtacaacaacgatcgacaaggctggtaatatcttgcgt
ggttatgatcgggtccaagaaaagctgcgtcaacttggagctgatgtaactatcaaggat
gatcctgctgtaccgggtattttagataatatttag

DBGET integrated database retrieval system