KEGG   Lactobacillus crispatus: LCRIS_00328Help
Entry
LCRIS_00328       CDS       T01222                                 

Gene name
truA
Definition
tRNA pseudouridine synthase a
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
lcr  Lactobacillus crispatus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332867..333655
Genome map
AA seq 262 aa AA seqDB search
MTTRYKMTMAYDGHLFHGFQLQPDQRTVQGTIEDALKKMTKGQRVIVQGSGRTDAGVHAV
GQVIHFDYPGKTIPANRMILAMNSMMPTDIIFDDCQIVDENFHARYSIKGKWYRYRVSLD
HFVNPFKRFYTGHFPYPLDIEKMQVAAQDLLGKHDFTSFAASGGQIENKVRTIYYVNITK
DEKENEVIFDFIGSGFLYNMVRIMVAALLEIGNDRRPIHDLQRVIAAKDRQEVRQTAHAS
GLYLYHVFYDEIPQKYRLDQHL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagatataaaatgacgatggcttatgatggtcatctttttcatggctttcaa
cttcaaccagaccagcgaactgttcaggggacaattgaagatgcgttgaagaaaatgact
aaggggcagcgtgtgattgtgcaggggtcaggtagaactgatgccggtgtacatgcggtt
ggacaggtaattcattttgattatcctggtaaaactattccagccaatcgaatgattttg
gcaatgaattctatgatgccaaccgatattatctttgatgattgccaaattgttgatgag
aattttcatgcgcgttattcgattaagggaaaatggtatcgctatcgtgttagtttagat
cattttgttaatccttttaagcgtttttatactggtcattttccgtatccattagatatt
gaaaaaatgcaggttgcagctcaggacttattgggtaagcacgattttaccagttttgcg
gccagcggtggtcaaattgaaaataaagttcggaccatttattatgtaaacattactaaa
gacgaaaaagaaaatgaagtaatttttgattttattggttcaggctttttgtataatatg
gtacggattatggtagcggcgctactggaaattggtaatgatcgtaggccaattcatgac
ttgcaacgagtaattgctgccaaggatcgtcaagaggtaagacaaactgctcatgcgagt
ggtttgtacctttatcatgttttttacgatgaaatcccacaaaaatatcgtttagaccag
catttataa

DBGET integrated database retrieval system