KEGG   Lactobacillus crispatus: LCRIS_00340Help
Entry
LCRIS_00340       CDS       T01222                                 

Gene name
gpmA2
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcr  Lactobacillus crispatus
Pathway
lcr00010  Glycolysis / Gluconeogenesis
lcr00260  Glycine, serine and threonine metabolism
lcr00680  Methane metabolism
lcr01100  Metabolic pathways
lcr01110  Biosynthesis of secondary metabolites
lcr01120  Microbial metabolism in diverse environments
lcr01130  Biosynthesis of antibiotics
lcr01200  Carbon metabolism
lcr01230  Biosynthesis of amino acids
Module
lcr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_00340 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    LCRIS_00340 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCRIS_00340 (gpmA2)
Enzymes [BR:lcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCRIS_00340 (gpmA2)
Membrane trafficking [BR:lcr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LCRIS_00340 (gpmA2)
Exosome [BR:lcr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCRIS_00340 (gpmA2)
  Exosomal proteins of melanoma cells
   LCRIS_00340 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBL49787
UniProt: D5H1A2
Position
341039..341719
Genome map
AA seq 226 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTKKGEEQAEKAGELIKTISDFAPTHIHTSVLS
RAIVTANIVADVCNLLWLPMTKTWRLNERHYGALRGLNKDISRKVFGVEQVLLWRRSFDS
VPPKQGSPMIDRRYKHFDQHLMPRAESLHQTQKRLMPYYYDHIASRLMNGEDQLIVAHGS
SLRALIKKLEQINDHDIVKLEVPNAEPIVYTMDEHLKIINKQILRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtattagttcgacatggcgaaagtgtggcaaatgctgccaatgtttat
actggctggaacgatgttccgttgactaaaaaaggtgaagaacaagcagaaaaagctggt
gaattgattaaaaccatttcggattttgctcccacccacattcatacttcagtcttatcc
cgtgcaattgtgacagcaaatatagtagccgatgtttgcaatttattatggctaccgatg
actaagacctggcggctgaatgaacgccactacggtgctttaaggggccttaataaggac
atttcacgtaaagtatttggtgtggaacaagttctattgtggcgacgtagttttgattca
gttccacctaagcaggggtcgccaatgattgatcgccgttataagcattttgatcagcat
ttgatgccacgggcagaaagtttacatcaaactcagaaaagactcatgccatattattat
gatcatatcgcatctcgattgatgaatggtgaagaccaactgatcgtagcccacggttca
agtttgcgtgctttgataaaaaagctagagcagattaatgatcatgacatcgtaaaactg
gaagttcctaatgcggaaccgattgtttatactatggatgagcacttaaagattattaac
aaacaaattttacgtaaataa

DBGET integrated database retrieval system