KEGG   Lactobacillus crispatus: LCRIS_00340Help
Entry
LCRIS_00340       CDS       T01222                                 

Gene name
gpmA2
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCRIS_00340 (gpmA2)
   01230 Biosynthesis of amino acids
    LCRIS_00340 (gpmA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_00340 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    LCRIS_00340 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCRIS_00340 (gpmA2)
Enzymes [BR:lcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCRIS_00340 (gpmA2)
Exosome [BR:lcr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCRIS_00340 (gpmA2)
  Exosomal proteins of melanoma cells
   LCRIS_00340 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341039..341719
Genome map
AA seq 226 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTKKGEEQAEKAGELIKTISDFAPTHIHTSVLS
RAIVTANIVADVCNLLWLPMTKTWRLNERHYGALRGLNKDISRKVFGVEQVLLWRRSFDS
VPPKQGSPMIDRRYKHFDQHLMPRAESLHQTQKRLMPYYYDHIASRLMNGEDQLIVAHGS
SLRALIKKLEQINDHDIVKLEVPNAEPIVYTMDEHLKIINKQILRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtattagttcgacatggcgaaagtgtggcaaatgctgccaatgtttat
actggctggaacgatgttccgttgactaaaaaaggtgaagaacaagcagaaaaagctggt
gaattgattaaaaccatttcggattttgctcccacccacattcatacttcagtcttatcc
cgtgcaattgtgacagcaaatatagtagccgatgtttgcaatttattatggctaccgatg
actaagacctggcggctgaatgaacgccactacggtgctttaaggggccttaataaggac
atttcacgtaaagtatttggtgtggaacaagttctattgtggcgacgtagttttgattca
gttccacctaagcaggggtcgccaatgattgatcgccgttataagcattttgatcagcat
ttgatgccacgggcagaaagtttacatcaaactcagaaaagactcatgccatattattat
gatcatatcgcatctcgattgatgaatggtgaagaccaactgatcgtagcccacggttca
agtttgcgtgctttgataaaaaagctagagcagattaatgatcatgacatcgtaaaactg
gaagttcctaatgcggaaccgattgtttatactatggatgagcacttaaagattattaac
aaacaaattttacgtaaataa

DBGET integrated database retrieval system