KEGG   Lactobacillus crispatus: LCRIS_00348Help
Entry
LCRIS_00348       CDS       T01222                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lcr  Lactobacillus crispatus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCRIS_00348 (gltX)
Enzymes [BR:lcr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LCRIS_00348 (gltX)
Amino acid related enzymes [BR:lcr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LCRIS_00348 (gltX)
Transfer RNA biogenesis [BR:lcr03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LCRIS_00348 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
347228..348727
Genome map
AA seq 499 aa AA seqDB search
MAKEKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIEDTDQKRNVKGGSKSQ
MENLHWLGIDWDEGPDKGGDYGPYRQSERKEIYQKYIDQLIDEGKAYYSYKTEEELEAQR
EEQRAAGVAPHYTYEYEGMTADEIKQAQDEAKAKGLKPVVRIHIPEMETYSWDDIVKGHL
EFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMKITHVLRGDDHVSNTPKQLVVYEALGW
EPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLPEAMFNFITLLGWSPKGENE
IFNKREFIKQFDPARLSKSPAAFDQKKLEWINNQYIKKADRDTLLDLALNNLQEAGLVDE
HPTPEKMEWVRQLVNIYSVQMSYTKQIVDMAKIFFEEAKDLSDEEIEEIKNDDGRGVIEE
FKKQLDLIPRFTSVQIMNAIQATRKATGIKGRKLFMPIRIATTRSMVGPGIGEAMELLGK
ERVLEHIDLTLKQMSANNL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagaaaaaatccgtgtaagatatgcaccaagtccaactggtcacttgcacatt
ggtaacgcacgtactgcactttttaactatttattcgctcgtcataacaagggtacgatg
gtcttgagaattgaagacaccgaccaaaagcgtaatgttaagggcggttctaagtctcaa
atggaaaaccttcactggttaggaattgactgggatgaaggccctgataagggtggcgac
tatggtccttatcgtcaatcagaaagaaaagaaatttaccaaaagtatattgatcaattg
atcgatgaaggtaaagcatattactcatacaagactgaggaagaacttgaagcacaacgt
gaagaacagcgtgctgcaggtgttgcacctcactatacttacgaatatgagggtatgact
gctgatgaaattaagcaagctcaagatgaagcaaaggctaagggcttaaagccagttgtt
cgtatccacattccagaaatggaaacttattcatgggatgatattgttaagggacacctt
gagtttgaatcagacactattggtggggatttcgttattcaaaagcgtgacggaatgcca
acttacaactttgccgtagttatcgatgaccacttgatgaagatcactcacgtacttcgt
ggtgatgatcacgtttctaacacacctaagcaattagttgtttatgaggcacttggttgg
gaacctcctaagtttggtcatatgacattgatcattaattcagaaactggtaaaaaactt
tctaagcgtgacgaatcagttcttcaatttattgaacaatatcgtgatcttggttactta
ccagaagctatgtttaacttcattactcttcttggttggtcaccaaagggtgaaaacgaa
atctttaacaagcgtgaattcatcaagcaatttgaccctgcacgtttgtctaagtcacct
gctgcttttgaccaaaagaaacttgaatggattaacaaccaatacatcaagaaggctgat
cgcgacactttgcttgatttagctttgaacaacttgcaagaagcaggtcttgttgatgag
catccaacaccagaaaagatggaatgggttcgtcaattggttaacatctactcagtacaa
atgtcatacactaagcaaattgtagacatggctaagattttctttgaagaagctaaggat
ctttcagacgaagaaatcgaagaaatcaagaatgatgatggccgtggtgtaattgaagaa
ttcaagaagcaattagacctcatcccaagatttacttcagttcaaatcatgaacgctatt
caagcaactcgtaaggctactggcatcaagggaagaaagctctttatgccaattagaatt
gctaccacgcgttcaatggttggacctggtattggcgaagcaatggagcttttaggtaaa
gaacgtgtattagaacacattgatttaaccttgaagcaaatgagtgctaataatctttaa

DBGET integrated database retrieval system