KEGG   Lactobacillus crispatus: LCRIS_00380Help
Entry
LCRIS_00380       CDS       T01222                                 

Gene name
recR
Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
lcr  Lactobacillus crispatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lcr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371256..371855
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIAHLIDAYMKLPGIGEKTATRLAFYTMDMPDQDVDDFAKSLVQVKKDIHQCPIC
GNITEKDVCDICSNPNRDQTTIMVVEQPKDLMAFEEMGEYDGLYHVLHGVLSPMDGIGPE
EINIKSLITRLQKNDAVKEVILALNSTPEGESTAMYISKLIKPAGIKVTRLAAGLSVGSD
IEYANSITLKRAVQGRTAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatccattaccaattgctcatttaattgatgcttatatgaagctacctggaatc
ggtgaaaaaacggcgactcggttggctttttatacgatggatatgcctgatcaggatgtc
gatgattttgctaagtctttagttcaagtaaaaaaagacattcatcaatgtccgatctgt
ggcaatattaccgaaaaagacgtctgtgatatttgctctaatcctaatcgcgatcaaaca
actattatggtagttgaacaaccaaaggatttgatggcttttgaggaaatgggcgaatat
gacggactttatcacgtgcttcatggtgttctttcaccaatggatggaattggaccagaa
gagatcaatatcaagtctttaattacgcgtttgcaaaaaaatgatgctgttaaagaagtg
attttggcgcttaattcaactccagaaggcgaatcaactgcgatgtatatcagcaaatta
attaagccagctggtattaaggtaaccagattggccgctggtttgtcagttggtagtgac
attgaatatgctaattccattactttaaagcgcgcagtgcaaggaagaacggcattataa

DBGET integrated database retrieval system